DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt10a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio


Alignment Length:354 Identity:109/354 - (30%)
Similarity:173/354 - (48%) Gaps:63/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-SIETRGK----RNIFKK 298
            |..:|. |::|...|.:...:..:..:..::|...|:.|||..|||| |:|||.|    ..:|.:
Zfish    98 CLTLPGLTKKQLDVCMRNPDVTASAIQGIQIAIHECQHQFRGHRWNCSSLETRNKIPYESVVFSR 162

  Fly   299 LYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNRE----------------------- 340
            .::|:||.:|:.||.:.|:::.|||.|::..|.|..|:...|                       
Zfish   163 GFRESAFAYAIAAAGVVHAVSNACAMGKLKACGCDEKRRGDEEAFRIKLNRLQLEAINRGKGMVH 227

  Fly   341 ------------AQD-FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQ 392
                        .|| ::||||:.|:::|:|.::.|||.|....|..|.:..|::.||.:.|...
Zfish   228 GVMEHFPAEALGPQDSWEWGGCSPNVEYGERFSKDFLDSRETYRDIHSRMRLHNNRVGRQVVVDH 292

  Fly   393 MMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRR 457
            |..||||||.||||.:||||:...:|....:||::::|.|.....:.|:..||.::.   ...||
Zfish   293 MRRKCKCHGTSGSCQLKTCWQVTPEFRTVGSLLKERFNVATLIKAHNRNTGQVENAH---HTHRR 354

  Fly   458 KKPQQSQYTTLYYLETSPSYC--------AVTKDRQCLHP----DNCGTLCCGRGYTTQVVKQVE 510
            :    :....|.|.|.||.:|        |.|:.|.|...    |||.:||||||:......:.|
Zfish   355 R----ANINDLVYFEKSPDFCERDLGSDSAGTQGRICNKTSQGMDNCESLCCGRGHNILQQTRSE 415

  Fly   511 KCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            :|.|:|:  .||.::|:.|:..|....||
Zfish   416 RCNCKFH--WCCYVVCEECRITEWVSVCK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 105/345 (30%)
wnt10aNP_571055.1 wnt 104..442 CDD:278536 105/346 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.