DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt1

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_005162280.1 Gene:wnt1 / 30128 ZFINID:ZDB-GENE-980526-526 Length:375 Species:Danio rerio


Alignment Length:316 Identity:107/316 - (33%)
Similarity:167/316 - (52%) Gaps:33/316 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY----KETAFV 306
            :|||....|:..|:...::.....|...|:.|||..||||  .|....|:|.|:.    :|||||
Zfish    69 SRRQRKLIRQNPGILHAIAAGLHTAIKECKWQFRNRRWNC--PTTHSPNVFGKIVNRGCRETAFV 131

  Fly   307 HALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDL--RGG 369
            .|:|:|.:||::||:|:||.:..|:|..::......|:.||||:||::.|:...|.|:|.  ||.
Zfish   132 FAITSAGVTHAVARSCSEGAIESCTCDYRRRGPGGPDWHWGGCSDNVEFGRMFGREFVDSSERGR 196

  Fly   370 DGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIR 434
            |...::.:  |::|.|...|:|:|..:|||||:||||:::|||.::..|......|:.:::.|.|
Zfish   197 DLRYLTNL--HNNEAGRMTVASEMQQECKCHGMSGSCTVRTCWMRLPSFRLVGDYLKDRFDGASR 259

  Fly   435 -----KAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQC 486
                 |..|:.|.|  :..|..:|:....|...|:  .|.|.|.||::|:.        |..|.|
Zfish   260 VVYANKGSNRASHR--ADPRHLEPENPAHKLPSSR--DLVYFEKSPNFCSYNGKTGTHGTSGRTC 320

  Fly   487 LHP----DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
            ...    |.|..|||||||.|::.:..|:|.|.|:  .||.:.|..|...:..:.|
Zfish   321 NSSSPALDGCELLCCGRGYKTRMEQVTERCHCTFH--WCCHVSCLNCTSTQTVHQC 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 107/316 (34%)
wnt1XP_005162280.1 WNT1 64..375 CDD:128408 107/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.