DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt9a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001099253.2 Gene:Wnt9a / 287357 RGDID:1305018 Length:365 Species:Rattus norvegicus


Alignment Length:330 Identity:119/330 - (36%)
Similarity:184/330 - (55%) Gaps:54/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETA 304
            |..:...|:|...||::.|:..||.||..::...|:.|||::||||::|.|.:.::.|:.:||||
  Rat    59 CDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFKETA 123

  Fly   305 FVHALTAAAMTHSIARACAEGRMTKCSC--GPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLR 367
            |::|:::|.:||::|:||:.|||.:|:|  .|...||||  :|||||.||||:..:..:.||   
  Rat   124 FLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREA--WQWGGCGDNLKYSSKFVKEFL--- 183

  Fly   368 GGDGDEVSEILR-----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQ 427
               |...|:.||     |::.||::.:.:.:...||||||||||:::|||:::|.|:.....|:.
  Rat   184 ---GRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKH 245

  Fly   428 KY----------NEAIRKA-----PNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSY 477
            ||          |||..:|     |..|:    |.|....|..|..:        |.:|:.|||:
  Rat   246 KYETSLKVGSTTNEATGEAGAISPPRGRA----SGSGGGDPLPRTPE--------LVHLDDSPSF 298

  Fly   478 CAV------TKDRQCLHPDNCGTLCCGRGYTTQ--VVKQVEKCRCRFNNGRCCQLICDYCQRLEN 534
            |..      |..|:|....||.::|||||:.||  ||.:..:|:.|:    ||.:.|..|.:.|.
  Rat   299 CLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRW----CCYVECRQCTQREE 359

  Fly   535 KYFCK 539
            .|.||
  Rat   360 VYTCK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 116/322 (36%)
Wnt9aNP_001099253.2 Wnt 64..364 CDD:393294 116/323 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003784
OrthoInspector 1 1.000 - - otm45933
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.