DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt5b

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001093959.1 Gene:Wnt5b / 282582 RGDID:628850 Length:372 Species:Rattus norvegicus


Alignment Length:329 Identity:108/329 - (32%)
Similarity:164/329 - (49%) Gaps:46/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY--- 300
            |..:|. :..|...|:........:.|..:.....|:.|||..|||||  |....::|.::.   
  Rat    61 CSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCS--TVDNLSVFGRVMQIG 123

  Fly   301 -KETAFVHALTAAAMTHSIARACAEGRMTKCSCG----PKKHNREAQDFQWGGCNDNLKHGKRVT 360
             :||||.:|::||.:.::|:|||.||.::.|.|.    ||...|   |:.||||.||:::|.|..
  Rat   124 SRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPR---DWLWGGCGDNVEYGYRFA 185

  Fly   361 RSFLDLRGGD------GDEVSEILRH--DSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMAD 417
            :.|:|.|..:      .:|....|.:  ::|.|..||.......|||||||||||:||||.::|:
  Rat   186 KEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVSCKCHGVSGSCSLKTCWLQLAE 250

  Fly   418 FNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC---- 478
            |......|::||:.|......::...::::||..:|     .|:.     |.|::.||.||    
  Rat   251 FRKVGDRLKEKYDSAAAMRITRQGKLELTNSRFNQP-----SPED-----LVYVDPSPDYCLRNE 305

  Fly   479 ----AVTKDRQCLH----PDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENK 535
                ..|:.|.|..    .|.|..:||||||......|||:|.|||:  .||.:.|..|..:.::
  Rat   306 TTGSLGTQGRLCNKTSEGTDGCELMCCGRGYDRFKSVQVERCHCRFH--WCCFVRCKKCTEIVDQ 368

  Fly   536 YFCK 539
            |.||
  Rat   369 YVCK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 104/320 (33%)
Wnt5bNP_001093959.1 Wnt 61..372 CDD:393294 106/327 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.