DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt3

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_017452517.1 Gene:Wnt3 / 24882 RGDID:3972 Length:367 Species:Rattus norvegicus


Alignment Length:383 Identity:116/383 - (30%)
Similarity:168/383 - (43%) Gaps:85/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GTMLNGGGVGGAAG-----MGLGIGSNTNNMDMQQGLYNEHFISEHTVMAVFTSQGQVGGPCRYM 243
            ||.|.||.:....|     .|.|:.    |:.: ||.:..|.      ..::.|...:...|   
  Rat    43 GTELIGGVLAKVQGWKPRAQGQGVA----NLAL-QGAFRSHH------RPLYLSIVALNSVC--- 93

  Fly   244 PATRR--QNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFV 306
            |:|:|  ......:.||  |:|:.....||                             :|:|||
  Rat    94 PSTKRIILRSGLLRATG--GSLALHPMTAT-----------------------------RESAFV 127

  Fly   307 HALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDG 371
            ||:.:|.:..::.|:||||..|.|.|.........:.::||||:::...|..|:|.|.|.|....
  Rat   128 HAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP 192

  Fly   372 DEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEA---- 432
            |..|.:.:|::|.|...:...|..||||||:||||.:||||....||.|....|:.||:.|    
  Rat   193 DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMV 257

  Fly   433 IRKAPNQRSMRQVSSSRMK----KPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQ 485
            :.|  ::.|...|.:.|.|    ||...|         .|.|.|.||::|..        |:||.
  Rat   258 VEK--HRESRGWVETLRAKYALFKPPTER---------DLVYYENSPNFCEPNPETGSFGTRDRT 311

  Fly   486 C---LHP-DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            |   .|. |.|..||||||:.|:..|:.|||.|.|:  .||.:.|..|.|:.:.:.||
  Rat   312 CNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFH--WCCYVSCQECIRIYDVHTCK 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 99/314 (32%)
Wnt3XP_017452517.1 Wnt_Wnt3_Wnt3a <119..367 CDD:381709 93/289 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.