DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt6

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus


Alignment Length:349 Identity:108/349 - (30%)
Similarity:161/349 - (46%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VGGP--------CRYMPATR---RQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIET 289
            ||.|        ||  .|.|   ||...|:.|..:...|:...||....|:.|||:.|||||..:
Mouse    28 VGSPLVMDPTSICR--KARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHS 90

  Fly   290 RGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSC---------------------G 333
            :....:.::..:|||||.|:|||..:|::.:||:.|.:.:|.|                     |
Mouse    91 KAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPG 155

  Fly   334 PKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDL--RGGDGDEVSEILRHDSEVGIEAVSSQMMDK 396
            |......:..::||||.|::..|...:|.|:|.  :.|.||..:.:..|::|.|..||.|....:
Mouse   156 PTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTE 220

  Fly   397 CKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQ 461
            |||||:||||:::|||:|:..|......|.::::.|.|..........:.:.|..||..|     
Mouse   221 CKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGR----- 280

  Fly   462 QSQYTTLYYLETSPSYCAV--------TKDRQC--LHPD--NCGTLCCGRGYTTQVVKQVEKCRC 514
                ..|.|...||.:||.        |:.|.|  ..||  .|..||||||:..:.|:..|.|.|
Mouse   281 ----ADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLC 341

  Fly   515 RFNNGRCCQLICDYCQRLENKYFC 538
            ||:  .||.:.|..|:..:....|
Mouse   342 RFH--WCCVVQCHRCRVRKELSLC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 102/331 (31%)
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 105/343 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.