DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt2

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_006505108.1 Gene:Wnt2 / 22413 MGIID:98954 Length:368 Species:Mus musculus


Alignment Length:343 Identity:118/343 - (34%)
Similarity:174/343 - (50%) Gaps:61/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 PCRYMPATRRQNH-QCRKETGLPGTLSEARRLA-----------------TTHCEEQFRYDRWNC 285
            |.|||.||...:. .|   ..:||.:|..|:|.                 |..|:.|||..||||
Mouse    34 PDRYMRATGGSSRVMC---DNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNC 95

  Fly   286 SIETRGKRNIFKKLY----KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQD--- 343
            :...| ..::|.::.    :|:|||:|:::|.:..:|.|||::|.:..|||.|||.. .|:|   
Mouse    96 NTLDR-DHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKG-SAKDSKG 158

  Fly   344 -FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSC 406
             |.||||:||:.:|.:..|:|:|.:...|.:...::. |::..|.:||...:..:||||||||||
Mouse   159 TFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSC 223

  Fly   407 SMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMR-QVSSSRMKKPKQRRKKPQQSQYTTLYY 470
            :::|||..||||..|...|.:|||.||:...||.... .|::.|.|||.:          ..|.|
Mouse   224 TLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTK----------NDLVY 278

  Fly   471 LETSPSYCAVTKDRQC--------------LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRC 521
            .|.||.||  .:||:.              ...|:|..:||||||.|..|.::.||.|:|:  .|
Mouse   279 FENSPDYC--IRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFH--WC 339

  Fly   522 CQLICDYCQRLENKYFCK 539
            |.:.|..|....:.:.||
Mouse   340 CAVRCQDCLEALDVHTCK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 111/334 (33%)
Wnt2XP_006505108.1 Wnt_Wnt2 44..357 CDD:381719 110/331 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.