DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt10b

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_035848.1 Gene:Wnt10b / 22410 MGIID:108061 Length:389 Species:Mus musculus


Alignment Length:347 Identity:104/347 - (29%)
Similarity:160/347 - (46%) Gaps:65/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKR-----NIFKKLYKETAF 305
            ::||...|.:...:..:..:...:|...|:.|.|..|||||....|.|     .|.|:.::|:||
Mouse    55 SKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAF 119

  Fly   306 VHALTAAAMTHSIARACAEGRMTKCSCGPKKHNRE------------------------------ 340
            ..::.||.:.|::|.||:.|::..|.||.|....:                              
Mouse   120 SFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKTFPISQPSPVPGS 184

  Fly   341 -----AQD-FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKC 399
                 .|| ::|||||.::..|::.:|.|||.|....|..:.:..|::.||.:.|:..:..||||
Mouse   185 VPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVTENLKRKCKC 249

  Fly   400 HGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQ 464
            ||.||||..||||:...:|.|....||::.:.||....:.|:    |.:...:.:.||...:   
Mouse   250 HGTSGSCQFKTCWRAAPEFRAIGAALRERLSRAIFIDTHNRN----SGAFQPRLRPRRLSGE--- 307

  Fly   465 YTTLYYLETSPSYC--------AVTKDRQCLHP----DNCGTLCCGRGYTTQVVKQVEKCRCRFN 517
               |.|.|.||.:|        ..|:.|.|...    |.||:||||||:......:||:|.|||:
Mouse   308 ---LVYFEKSPDFCERDPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCHCRFH 369

  Fly   518 NGRCCQLICDYCQRLENKYFCK 539
              .||.::||.|:..|....||
Mouse   370 --WCCYVLCDECKVTEWVNVCK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 102/345 (30%)
Wnt10bNP_035848.1 Wnt_Wnt10b 45..389 CDD:381730 102/345 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.