DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt1

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_067254.1 Gene:Wnt1 / 22408 MGIID:98953 Length:370 Species:Mus musculus


Alignment Length:312 Identity:103/312 - (33%)
Similarity:163/312 - (52%) Gaps:26/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY----KETAFV 306
            :|:|....|:..|:..::|...:.|...|:.|||..||||  .|....::|.|:.    :||||:
Mouse    65 SRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNC--PTAPGPHLFGKIVNRGCRETAFI 127

  Fly   307 HALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDG 371
            .|:|:|.:|||:||:|:||.:..|:|..::......|:.||||:||:..|:...|.|:| .|..|
Mouse   128 FAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVD-SGEKG 191

  Fly   372 DEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRK 435
            .::..::. |::|.|...|.|:|..:|||||:||||:::|||.::....|...:||.:::.|.|.
Mouse   192 RDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRV 256

  Fly   436 APNQRSMRQVSSSRMKK--PKQRRKKPQQSQYTTLYYLETSPSYC--------AVTKDRQCLHP- 489
            ....|...:.|.:.:.:  |:....||....  .|.|.|.||::|        |.|..|.|... 
Mouse   257 LYGNRGSNRASRAELLRLEPEDPAHKPPSPH--DLVYFEKSPNFCTYSGRLGTAGTAGRACNSSS 319

  Fly   490 ---DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
               |.|..||||||:.|:..:..|:|.|.|:  .||.:.|..|......:.|
Mouse   320 PALDGCELLCCGRGHRTRTQRVTERCNCTFH--WCCHVSCRNCTHTRVLHEC 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 103/312 (33%)
Wnt1NP_067254.1 WNT1 60..370 CDD:128408 103/312 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.