DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt8a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_033316.2 Gene:Wnt8a / 20890 MGIID:107924 Length:354 Species:Mus musculus


Alignment Length:312 Identity:92/312 - (29%)
Similarity:155/312 - (49%) Gaps:34/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 RKETGLPGTLSEA--RRLATTHCEEQFRYDRWNC-----SIETRGKRNIFKKLYKETAFVHALTA 311
            |.:..|..|.|.|  .::....|:.||.::||||     ...|   .|..:...:||:|:||:.:
Mouse    32 RPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFST---HNRLRAATRETSFIHAIRS 93

  Fly   312 AAMTHSIARACAEGRMTKCSCGPKKHNRE-AQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVS 375
            ||:.:::.:.|:.|.:..|.|...::.:. ...:.||||:||::.|::::|.|:|......|..:
Mouse    94 AAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARA 158

  Fly   376 EILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQR 440
            .:..|::..|..||.:.....|||||:|||||::|||.::|||......|:.||:.|::...::|
Mouse   159 LVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKR 223

  Fly   441 SMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC--------AVTKDRQCL---------H 488
            .:|..:.:..:........|  |....|.:||.||.||        ..|:.|:||         .
Mouse   224 QLRAGNRAEGRWALTEAFLP--STEAELIFLEGSPDYCNRNASLSIQGTEGRECLQNARSASRRE 286

  Fly   489 PDNCGTLC--CGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
            ..:||.||  ||.....:..:.|..|.|.|.  .||.:.|..|:|:.::|:|
Mouse   287 QRSCGRLCTECGLQVEERRAEAVSSCDCNFQ--WCCTVKCGQCRRVVSRYYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 92/312 (29%)
Wnt8aNP_033316.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.