DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and lin-44

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001021081.1 Gene:lin-44 / 171994 WormBaseID:WBGene00003029 Length:348 Species:Caenorhabditis elegans


Alignment Length:308 Identity:86/308 - (27%)
Similarity:136/308 - (44%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 GLPGTLSEARRLAT------TH-----------------CEEQFRYDRWNCSIETRGKRN--IFK 297
            |.|..|..:|.|.:      ||                 |..:.|:.:|:||.......:  :.:
 Worm    52 GCPSDLLHSRALRSIQLACRTHPATVISAFEGVQEGLQNCANRLRFQQWDCSEAGNIMHDPPLLR 116

  Fly   298 KLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQ-DFQWGGCNDNLKHGKRVTR 361
            :.::|::.:.||::|:....:|.|||:|.:..|:|    :|:..| ::::|||...::||...:|
 Worm   117 QGFRESSLIWALSSASAAWGVATACAQGWIDDCAC----NNQMGQNEYEFGGCTHGVQHGITASR 177

  Fly   362 SFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLR 426
            ..|...|.....:.::.:|:.:.|..|:...::..||||||||||..|||||:.|........|.
 Worm   178 KLLTKVGAVNTLLRKVEKHNLKAGRLAIKKTLISSCKCHGVSGSCQQKTCWKRTATLEHITDYLV 242

  Fly   427 QKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--TKDRQC--- 486
            :||         .|:......|.:|.             |.|.|||.||..|..  ...|.|   
 Worm   243 EKY---------ARAKLYTDDSVVKT-------------TDLIYLEASPDVCKAKSVAGRVCAWR 285

  Fly   487 --LHPD-NCGTLCCGRGYTT--QVVKQVEKCRCRFNNGRCCQLICDYC 529
              .|.. :|..||||.|::.  :||:  .||.|.|  ..||.|:|..|
 Worm   286 NETHTQGDCDRLCCGNGFSIRHEVVR--VKCDCEF--VWCCNLVCKDC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 86/308 (28%)
lin-44NP_001021081.1 WNT1 64..339 CDD:128408 81/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.