DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt11

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_536326.1 Gene:Wnt11 / 140584 RGDID:621463 Length:354 Species:Rattus norvegicus


Alignment Length:313 Identity:112/313 - (35%)
Similarity:160/313 - (51%) Gaps:43/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-SIE---------TRGKRNIFKKLYKETAFVH 307
            ||....|..|:..|.|.|...|...|...|||| |||         .||.|        |:|||:
  Rat    59 CRSNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTR--------ESAFVY 115

  Fly   308 ALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLR---GG 369
            ||:||.::|:|||||..|.:..|||||..........:||||.|||.:|..:...|.|..   ..
  Rat   116 ALSAATISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK 180

  Fly   370 DGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAI 433
            .|.:.::::| |:||||.:|:.:.:..||||||||||||::||||.:.:....|..|:.:|..|.
  Rat   181 TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTRYLSAT 245

  Fly   434 RKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQCLH-- 488
            :..     .|.:.:.:...||....:|.:.  :.|.||::||.:|..        |:||||..  
  Rat   246 KVV-----HRPMGTRKHLVPKDLDIRPVKD--SELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTS 303

  Fly   489 --PDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
              .|:|..:||||||.....:.||:|.|:::  .||.:.|..|:|...:|.||
  Rat   304 NGSDSCDLMCCGRGYNPYTDRVVERCHCKYH--WCCYVTCRRCERTVERYVCK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 110/311 (35%)
Wnt11NP_536326.1 Wnt_Wnt11 51..354 CDD:381717 110/311 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.