DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt9a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_031760059.1 Gene:wnt9a / 101734951 XenbaseID:XB-GENE-5895367 Length:402 Species:Xenopus tropicalis


Alignment Length:317 Identity:115/317 - (36%)
Similarity:186/317 - (58%) Gaps:31/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETA 304
            |..:...|:|...||::.|:..||.||..::...||.||.::||||::|.|.:.::.|:.:||||
 Frog    99 CDRLKLERKQRRMCRRDPGVAETLIEAISMSAQECEYQFHFERWNCTLEGRYRASLLKRGFKETA 163

  Fly   305 FVHALTAAAMTHSIARACAEGRMTKCSC--GPKKHNREAQDFQWGGCNDNLKHGKRVTRSFL--- 364
            |::|:::|.:||::|:||:.|||.:|:|  .|...||||  :|||||.||||:..:..:.||   
 Frog   164 FLYAISSAGLTHAMAKACSAGRMERCTCDEAPDLENREA--WQWGGCGDNLKYSNKFVKEFLANK 226

  Fly   365 ---DLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLR 426
               |||       :.:..|::.|||:.:.:.:...||||||||||:::|||::::.|:.....|:
 Frog   227 SSKDLR-------ARVDLHNTNVGIKVIKAGVKTTCKCHGVSGSCTVRTCWRQLSPFHEIGKQLK 284

  Fly   427 QKYNEAIR-KAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAVTK------DR 484
            |||..::: .:....:..:...|..|||.... ..|..:.|.|.|::.|||:|.::|      .|
 Frog   285 QKYETSLKVGSTTNEATGEGDISPPKKPVAGH-SDQIPRTTDLIYIDDSPSFCRMSKYSPGTSGR 348

  Fly   485 QCLHPDNCGTLCCGRGYTTQ--VVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            :|....||.::|||||:.||  ||.:..:|:.|:    ||.:.|..|.:.|..|.||
 Frog   349 RCYKDKNCESICCGRGHNTQSNVVTRPCQCQVRW----CCYVECKECTQREEVYTCK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 112/309 (36%)
wnt9aXP_031760059.1 Wnt_Wnt9a 104..401 CDD:381727 112/310 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003784
OrthoInspector 1 1.000 - - oto104633
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.