DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt6a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_002662357.3 Gene:wnt6a / 100332722 ZFINID:ZDB-GENE-111114-1 Length:360 Species:Danio rerio


Alignment Length:371 Identity:111/371 - (29%)
Similarity:168/371 - (45%) Gaps:67/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 EHFISEHTVMAVFTS----QGQVGGPCRYMPATRRQNHQCRKETGLPG--------------TLS 264
            :|....|.::  ||:    |.:|.|    .|.....|..|||...|.|              .::
Zfish     6 KHVTWFHVIL--FTTLIPLQRRVNG----NPLVMDPNSICRKTRMLAGRHTDLCQSQPEIIQEVA 64

  Fly   265 EARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTK 329
            :..||....|:.||...||||:.:.|....|.::..:|||||:|:|||.:.|::.:||::|.:.:
Zfish    65 KGARLGIRECQHQFHNHRWNCTSQGRNLAKILQQDIRETAFVYAVTAAGVMHAVTQACSQGALPQ 129

  Fly   330 CSCGPKKHNRE------AQD------------FQWGGCNDNLKHGKRVTRSFLDL--RGGDGDEV 374
            |.|...:.:.|      |::            ::||||.|::..|...:|.|:|:  |.|..|..
Zfish   130 CGCVTLQSSSETYRVSPAEEVLIQASSLHDWHWEWGGCGDDVDFGYEKSRQFMDIRQRKGKSDIR 194

  Fly   375 SEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQ 439
            |.|..|::|.|..|:..||..:|||||:||||::::|||||..|......|.|.::.|:|.....
Zfish   195 SLIDLHNNEAGRVAIQIQMRTECKCHGLSGSCTLRSCWKKMPLFRQVGDQLMQSFHTAVRVMGGN 259

  Fly   440 RSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQC----LHPDNC 492
            .....||......|...         ..|.|...||.:|..        |..|.|    ..|..|
Zfish   260 DGKSLVSIDPDAPPLDA---------NVLIYSAESPDFCKANHRSGTEGTGGRACNRTETGPGGC 315

  Fly   493 GTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
            .:||||.|:....|::.|.|.|||:  .||::.|..|.:.:|...|
Zfish   316 DSLCCGNGFADFTVEEEENCECRFH--WCCEVQCQTCSQRKNVSLC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 103/339 (30%)
wnt6aXP_002662357.3 wnt 45..359 CDD:278536 98/324 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.