DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt3

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001096552.1 Gene:wnt3 / 100125198 XenbaseID:XB-GENE-479567 Length:354 Species:Xenopus tropicalis


Alignment Length:324 Identity:110/324 - (33%)
Similarity:158/324 - (48%) Gaps:37/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-----SIETRGKRNIFKK 298
            |..:|. ..:|...||....:..:::|..:|....|:.|||..||||     |:...|.  :..|
 Frog    44 CGSIPGLVPKQMRFCRNYIEIMPSVAEGIKLGIQECQHQFRGRRWNCTTIHDSLAIFGP--VLDK 106

  Fly   299 LYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSF 363
            ..:|:|||||:.:|.:..::.|:||||..|.|.|...........::||||:::...|..|:|.|
 Frog   107 ATRESAFVHAIASAGVAFAVTRSCAEGSSTICGCDSHHKGSPGDGWKWGGCSEDADFGVLVSREF 171

  Fly   364 LDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQK 428
            .|.|....|..|.:.||::|.|...:...|..:|||||:||||.:||||....||.|....|:.|
 Frog   172 ADARENRPDARSAMNRHNNEAGRATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDK 236

  Fly   429 YNEAIRKA--PNQRSMRQVSSSRMK----KPKQRRKKPQQSQYTTLYYLETSPSYCAV------- 480
            |:.|...:  .::.|...|.:.|.|    ||...|         .|.|.||||::|..       
 Frog   237 YDSASEMSVEKHRESRGWVETLRAKYSLFKPPTER---------DLVYYETSPNFCEPNPETGSF 292

  Fly   481 -TKDRQC---LHP-DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
             |:.|.|   .|. |.|..||||||:.|:..|:.|||.|.|:  .||.:.|..|.|:.:.:.||
 Frog   293 GTQGRSCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFH--WCCYVSCQECVRIYDVHTCK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 106/315 (34%)
wnt3NP_001096552.1 Wnt_Wnt3_Wnt3a 41..354 CDD:381709 108/322 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.