DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFG1 and Dgp-1

DIOPT Version :9

Sequence 1:NP_609105.1 Gene:mEFG1 / 34004 FlyBaseID:FBgn0263133 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_611302.1 Gene:Dgp-1 / 37080 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster


Alignment Length:347 Identity:77/347 - (22%)
Similarity:130/347 - (37%) Gaps:70/347 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLTGN---NTLRLRALKSLGKAGYSSHAKFSEHKPIE-----RIRNIGISAHIDSGKTTLTERIL 63
            ||..|   :.::||..::  :.|.|  |:|...|.|:     .|| :.:..::|:||:||. .:|
  Fly   105 LLAANIDADVVKLRERRA--EKGQS--AQFLIRKHIDTTDFMEIR-VAVVGNVDAGKSTLL-GVL 163

  Fly    64 FYTGRIAEMHEVRGKDNVGATMDSMELERQRGITIQSAATYTLWKDTNINIIDTP--GHVDFTVE 126
            .:    .|:...||...........|:|..|   ..|.....|..|...|:::.|  ||:|:...
  Fly   164 TH----GELDNGRGHARQRLFRHKHEIESGR---TSSVGNDILGFDGVGNVVNKPDHGHLDWVKI 221

  Fly   127 VERALRVL------------------------DGAVLVLCAVGGVQSQTLTVNRQMKRYNVPCLA 167
            .|.:.:|:                        |..:|::.|..|:...|...........||...
  Fly   222 CENSAKVITFIDLAGHERYLKTTVFGMTGHAPDFGMLMIGANAGIIGMTKEHLGLALALAVPVFV 286

  Fly   168 FINKLDRLGSNPYRVLSQMRSKMNHNAAFIQLPIGVESNCKGIVDLVREKAIYFEGEHGMDIRLD 232
            .:.|:|...:|..:...::..||..:....::|:.|.|:     |.|...|..|..|     ||.
  Fly   287 VVTKIDMCPANVLQENMKLLFKMLKSQGCRKVPVVVRSH-----DDVVLSATNFVSE-----RLC 341

  Fly   233 EIPQDMRV--ESLERRQELIEHLSN---ADETLGELFLEEKPFTEDDIKAALRRTCINRTFTPVL 292
            .|.|...|  ::||..:..:..||.   ..|:|...|..:..:....:...:..||        |
  Fly   342 PIFQVSNVTGDNLELLKMFLNLLSTRMPGSESLPAEFQIDDVYAVPGVGTVVSGTC--------L 398

  Fly   293 VGTALKNKGVQPLLDAVLDYLP 314
            .||...|..:....|||..::|
  Fly   399 QGTIRLNDCLMLGPDAVGSFVP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFG1NP_609105.1 EF-G 44..316 CDD:206673 64/302 (21%)
PRK12740 48..727 CDD:237186 64/298 (21%)
mtEFG1_II_like 347..427 CDD:293908
EFG_III 441..516 CDD:293919
EFG_mtEFG1_IV 519..636 CDD:238715
mtEFG1_C 641..718 CDD:239764
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 77/347 (22%)
GTPBP1_like 145..367 CDD:206728 52/240 (22%)
GTPBP_II 376..462 CDD:293895 11/53 (21%)
GTPBP_III 468..553 CDD:294007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.