DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFG1 and mEFTu2

DIOPT Version :9

Sequence 1:NP_609105.1 Gene:mEFG1 / 34004 FlyBaseID:FBgn0263133 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster


Alignment Length:313 Identity:77/313 - (24%)
Similarity:118/313 - (37%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AKFSEHKPIERIR-----NIGISAHIDSGKTTLTERILFYTGRIAE---MHEVRGKDNVGATMDS 87
            |..::..|...:|     |:|...|:|.||||||..|.    ||..   :.|....|.:    |.
  Fly    41 ATSADKNPAPGLRELPHCNVGTIGHVDHGKTTLTAAIT----RIQSQKGLAEYLSYDQI----DR 97

  Fly    88 MELERQRGITIQSA-ATYTLWKDTNINIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQT 151
            ...|:.|||||.:. ..|:..:.|..: .|.|||.|:...:......:|||:||:.|..|...||
  Fly    98 APEEKARGITINACHIGYSTTERTYAH-TDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQT 161

  Fly   152 ---LTVNRQMKRYNVPCLAFINKLDRLGSNPYRVLSQMRSKMNHNAAFIQLPIGVESN--CKGIV 211
               |.:.:|:....:  :.||||.|.:......::.....:|..:..|    .||.|.  |...:
  Fly   162 REHLLLAKQVGIQRI--IVFINKADLVDQEVLELVEIEMREMLSDFGF----DGVNSPVICGSAL 220

  Fly   212 DLVREKAIYFEGEHGMDIRLDEIPQDMRVESLERRQELIEHLSNADETLGELFLEEKPFTEDDIK 276
            ..:||.    :.|.|             |.|:|:.      |...|..:        |..:.||.
  Fly   221 LALRED----KSEFG-------------VPSIEKL------LEQCDSYI--------PTPQRDIS 254

  Fly   277 AALRRTCINRTFT-----PVLVGTALKNKGVQPLLDAVLDYLPNPGEVENLGF 324
            :..... |:..||     .|:|||..:..            :|...:.:.|||
  Fly   255 SPFILP-IDNAFTVPGRGTVVVGTIKRGT------------IPRNADADLLGF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFG1NP_609105.1 EF-G 44..316 CDD:206673 71/285 (25%)
PRK12740 48..727 CDD:237186 72/291 (25%)
mtEFG1_II_like 347..427 CDD:293908
EFG_III 441..516 CDD:293919
EFG_mtEFG1_IV 519..636 CDD:238715
mtEFG1_C 641..718 CDD:239764
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 75/301 (25%)
EF_Tu 56..249 CDD:206671 61/238 (26%)
EFTU_II 257..343 CDD:293898 11/51 (22%)
mtEFTU_III 347..437 CDD:294005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.