powered by:
Protein Alignment mEFG1 and F58G1.8
DIOPT Version :9
Sequence 1: | NP_609105.1 |
Gene: | mEFG1 / 34004 |
FlyBaseID: | FBgn0263133 |
Length: | 745 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496753.1 |
Gene: | F58G1.8 / 186541 |
WormBaseID: | WBGene00010270 |
Length: | 83 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 28/58 - (48%) |
Similarity: | 39/58 - (67%) |
Gaps: | 0/58 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 417 VDCASGDTFTTNPKNNLSMESIFVPEPVVSMAIKPNNTKDRDNFSKAIARFTKEDPTF 474
:|..:.:||:|:.......|.|.:|||.:|:|:|..|.||.|||.||:.|||||:|||
Worm 18 LDLTARETFSTDQNLAPHCEPIHIPEPAISVALKSVNRKDADNFIKALTRFTKEEPTF 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0480 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003241 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.