DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFG1 and F58G1.8

DIOPT Version :9

Sequence 1:NP_609105.1 Gene:mEFG1 / 34004 FlyBaseID:FBgn0263133 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_496753.1 Gene:F58G1.8 / 186541 WormBaseID:WBGene00010270 Length:83 Species:Caenorhabditis elegans


Alignment Length:58 Identity:28/58 - (48%)
Similarity:39/58 - (67%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 VDCASGDTFTTNPKNNLSMESIFVPEPVVSMAIKPNNTKDRDNFSKAIARFTKEDPTF 474
            :|..:.:||:|:.......|.|.:|||.:|:|:|..|.||.|||.||:.|||||:|||
 Worm    18 LDLTARETFSTDQNLAPHCEPIHIPEPAISVALKSVNRKDADNFIKALTRFTKEEPTF 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFG1NP_609105.1 EF-G 44..316 CDD:206673
PRK12740 48..727 CDD:237186 28/58 (48%)
mtEFG1_II_like 347..427 CDD:293908 3/9 (33%)
EFG_III 441..516 CDD:293919 22/34 (65%)
EFG_mtEFG1_IV 519..636 CDD:238715
mtEFG1_C 641..718 CDD:239764
F58G1.8NP_496753.1 FusA <17..>79 CDD:357662 28/58 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0480
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003241
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.