DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and RTC2

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_009705.1 Gene:RTC2 / 852444 SGDID:S000000351 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:64/301 - (21%)
Similarity:115/301 - (38%) Gaps:80/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AASAMVIGGVIPYVPQYIEIKKTQDAEGFS-LYVCLALL----------VANSLRILFWFSSRY- 73
            |.|..:...::.:|||..|..:.|.|||.| |::.|.||          :.|.|..:...::.| 
Yeast    17 AGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFNVMGAMMQNLLPTMIILAAYYT 81

  Fly    74 --ELPLLVQ---------SVVMNVTMFL-MIHLCVKVKRVNANNREHALRGDELHLPKVMTDTDT 126
              :|.||:|         |::..|...: .:|| .....:|....:......|..||:: .:.|:
Yeast    82 LADLILLIQCMWYDKEKKSILQEVKKNVDPVHL-PPANPINETVLQDVFNEYEPLLPRI-EEEDS 144

  Fly   127 GASISTEAGGSVLKRVRSRHYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLWFM- 190
            .:..|.|.|.:::.:.|..          |:|        ||::|...:.|.|      :.|:: 
Yeast   145 QSYSSLELGRTIVVKEREN----------FFN--------DFLIVSGVLIAGI------LSWYIS 185

  Fly   191 -----------------------ESMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLG 232
                                   :.:|:::.........||.:.|||.||..|:|....:...||
Yeast   186 YCSGLDNGIPKKKPAFEQINLPAQILGYLSAILYLGSRIPQIVLNFKRKSCEGVSFLFFLFACLG 250

  Fly   233 DMFKTGYFIVRKAPSQFWICGTL-QVSLDIAILSQVWFYRK 272
            :   |.:.|  ...|..|:.|:. .:.:|..:..|.:.|.|
Yeast   251 N---TSFII--SVLSASWLIGSAGTLLMDFTVFIQFFLYAK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 18/68 (26%)
PQ-loop 193..248 CDD:282099 14/54 (26%)
RTC2NP_009705.1 PQ-loop 13..73 CDD:398045 17/55 (31%)
PQ-loop 208..265 CDD:398045 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.