DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and AT4G20100

DIOPT Version :10

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_193743.1 Gene:AT4G20100 / 827756 AraportID:AT4G20100 Length:288 Species:Arabidopsis thaliana


Alignment Length:104 Identity:29/104 - (27%)
Similarity:51/104 - (49%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKA--PSQFWICGT 254
            |:|.::|.:.::...||.:.|:..||..|:||..:..|.|||:|.....::..|  |.||:.  .
plant     9 SLGIISVISWSVAEIPQIMTNYNQKSIEGVSITFLTTWMLGDIFNVVGCLMEPASLPVQFYT--A 71

  Fly   255 LQVSLDIAILSQVWFYRKNSKPRDLR-RGDXQFAPEEQP 292
            :..:|...:|.....|..:..||.:: |.:.|....|:|
plant    72 VLYTLATLVLYVQSIYYGHIYPRLMKNRRNHQMVDVEEP 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 17..77 CDD:461220
PQ-loop 189..249 CDD:461220 18/58 (31%)
AT4G20100NP_193743.1 PQ-loop 6..66 CDD:461220 17/56 (30%)
PQ-loop 179..238 CDD:461220
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.