DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and AT2G41050

DIOPT Version :10

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_850340.1 Gene:AT2G41050 / 818704 AraportID:AT2G41050 Length:376 Species:Arabidopsis thaliana


Alignment Length:92 Identity:24/92 - (26%)
Similarity:47/92 - (51%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKA--PSQFWICGT 254
            |:|.::|.:..:...||.:.|:..|||.|:||..:..|.:||:|.....::..|  |:||::...
plant    14 SLGIISVISWGVAEIPQIMTNYSEKSTEGLSITFLTTWMIGDIFNLLGCLMEPATLPTQFYMALL 78

  Fly   255 LQVSLDIAILSQVWF---YRKNSKPRD 278
            ..|:..:..:..:::   |.:....||
plant    79 YTVTTSVLYVQSIYYGHIYPRLKNRRD 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 17..77 CDD:461220
PQ-loop 189..249 CDD:461220 18/58 (31%)
AT2G41050NP_850340.1 PQ-loop 11..70 CDD:461220 17/55 (31%)
PQ-loop 269..328 CDD:461220
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.