DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and slc66a2.1

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:NP_001017263.2 Gene:slc66a2.1 / 550017 XenbaseID:XB-GENE-988363 Length:271 Species:Xenopus tropicalis


Alignment Length:270 Identity:129/270 - (47%)
Similarity:172/270 - (63%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFSLYVCLALLVANSLRI 65
            ::||     |..:..:|.|.|:|||:.|||:||:|||.:|::||:|||||:||||.||:||.|||
 Frog     6 LEWI-----GAFLRLLVSWGASSAMIFGGVVPYIPQYRDIRRTQNAEGFSIYVCLMLLIANILRI 65

  Fly    66 LFWFSSRYELPLLVQSVVMNVTMFLMIHLCVKVKRVNANNREHALRGDELHLPKVMTDTDTGASI 130
            ||||...:|.|||.||::|.|||.||:.||.:|:..|..|            ||..:.|      
 Frog    66 LFWFGHHFESPLLWQSIIMIVTMLLMLKLCTEVRVANELN------------PKRRSFT------ 112

  Fly   131 STEAGGSVLKRVRSRHYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLWFMESMGF 195
            ::::.....|....|.:| |.|..:||:|:.|..|:..:|....|...||||.|....|:|.:||
 Frog   113 ASDSKDEEFKTHPKRCFL-DFDTAFFWHWSRFIDYVQCVLAFTGVTGYITYLFLDSTLFVEILGF 176

  Fly   196 VAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKAPSQFWICGTLQVSLD 260
            :||||||:||.||..||.:|.||.||||.||:|||.||.||:.||::.:||.||.|||.|||.:|
 Frog   177 LAVFTEALLGVPQLYRNHQNYSTEGMSIKMVLMWTSGDTFKSAYFVLNQAPFQFTICGLLQVFVD 241

  Fly   261 IAILSQVWFY 270
            ||||.||:.|
 Frog   242 IAILLQVYIY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 37/57 (65%)
PQ-loop 193..248 CDD:282099 34/54 (63%)
slc66a2.1NP_001017263.2 PQ-loop 17..77 CDD:367864 38/59 (64%)
PQ-loop 170..230 CDD:367864 36/59 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3125
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.