DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and Slc66a1

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_006239301.1 Gene:Slc66a1 / 362642 RGDID:1311627 Length:293 Species:Rattus norvegicus


Alignment Length:314 Identity:55/314 - (17%)
Similarity:104/314 - (33%) Gaps:116/314 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NDEMGLTVGHVVGWAAA-SAMVIGGVIPYVPQYIEIKKTQDAEGFSLYVCLALLVANSLRILFWF 69
            |.:..|::..::||... |..:||..:            .|......|..:..::|:.|.:..:|
  Rat    65 NMDQALSLWFLLGWIGGDSCNLIGSFL------------ADQLPLQTYTAVYYVLADLLMLTLYF 117

  Fly    70 SSRY-ELPLLVQSVVMNVTMFLMIHLCVKVKRVNANNREHALRGDELHLPKVMTDTDTGA----- 128
            ..:: :.|.|:.:.:.:|.:|::..:|:                     ..:::.||..|     
  Rat   118 HYKFKKQPSLLSAPINSVLLFILGTVCI---------------------TPLLSSTDPVAVPREG 161

  Fly   129 -----SISTEAGGSVLKRVRSRHYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLW 188
                 .:|.|.|.....:..                          :|.:.:|:|     .|||:
  Rat   162 FRGRTLLSVEPGNKPFTKKE--------------------------VVGFVIGSA-----SSVLY 195

  Fly   189 FMESMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMF--------------KTGY 239
            .:..:             ||...||..:||.|:|..:..:..||:..              ..|.
  Rat   196 LLSRL-------------PQIRTNFVRQSTQGISYSLFALVMLGNTLYGLSVLLKNPEVGQSEGS 247

  Fly   240 FIVRKAPSQFWICGTLQV-SLDIAILSQVWFYRKNSKPRDLRRGDXQFAPEEQP 292
            :::...|   |:.|:|.| .||..|..|...||.:         | ..|.|.:|
  Rat   248 YLLHHLP---WLVGSLGVLLLDTIISIQFLVYRSH---------DADAASEREP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 10/59 (17%)
PQ-loop 193..248 CDD:282099 12/68 (18%)
Slc66a1XP_006239301.1 PQ-loop 37..98 CDD:367864 8/44 (18%)
PQ-loop 183..243 CDD:367864 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.