DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and Slc66a2

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_006255014.1 Gene:Slc66a2 / 361352 RGDID:1305223 Length:271 Species:Rattus norvegicus


Alignment Length:312 Identity:127/312 - (40%)
Similarity:177/312 - (56%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFSLYVCLALLVANSLRI 65
            :.|::     :.:..:|.|.||.|||.|||:||:|||.:|::||:|:|||.:|||.|||||.|||
  Rat     6 LGWLL-----VPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRI 65

  Fly    66 LFWFSSRYELPLLVQSVVMNVTMFLMIHLCVKVK---RVNANNREHAL---RGDELHLPKVMTDT 124
            ||||...:|.|||.||:||.:||.||:.||.:|:   .:|...|..|.   :.:||.:|.     
  Rat    66 LFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEELRVPP----- 125

  Fly   125 DTGASISTEAGGSVLKRVRSRHYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLWF 189
                               .|.|| |.|..:||:|:.|..|:..:|....|...||||.:....|
  Rat   126 -------------------RRPYL-DFDPHHFWHWSSFADYVQCVLAFTGVAGYITYLSIDSALF 170

  Fly   190 MESMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKAPSQFWICGT 254
            :|::||:||.||||||.||..||::::||.|||:.||:|||.||.|||.||::..||.||.:||.
  Rat   171 VETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSLKMVLMWTSGDTFKTAYFLLNGAPLQFSVCGL 235

  Fly   255 LQVSLDIAILSQVWFYRKNSKPRDLRRGDXQFAPEEQPQHIHHHDIHTSHSE 306
            |||.:|:|||.|.                  :|....||....|.:|.:.::
  Rat   236 LQVMVDLAILGQA------------------YAFAHHPQKPAPHAVHPASAK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 37/57 (65%)
PQ-loop 193..248 CDD:282099 33/54 (61%)
Slc66a2XP_006255014.1 PQ-loop 17..77 CDD:398045 38/59 (64%)
PQ-loop 170..230 CDD:398045 35/59 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343231
Domainoid 1 1.000 49 1.000 Domainoid score I11531
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004636
OrthoInspector 1 1.000 - - oto95462
orthoMCL 1 0.900 - - OOG6_103454
Panther 1 1.100 - - LDO PTHR14856
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.