DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and pqlc1

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_021323964.1 Gene:pqlc1 / 101883969 -ID:- Length:270 Species:Danio rerio


Alignment Length:312 Identity:136/312 - (43%)
Similarity:185/312 - (59%) Gaps:50/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDWIINDEMGLTVGHVVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFSLYVCLALLVANSLRI 65
            ||.:|.|::...|..||.|.|:.|::.||::||:|||.:|::||:|||||.||||.|||||.|||
Zfish     1 MDEVIMDQVLYVVHQVVSWVASVAIIFGGIVPYIPQYRDIRRTQNAEGFSTYVCLVLLVANILRI 65

  Fly    66 LFWFSSRYELPLLVQSVVMNVTMFLMIHLCVKVK---RVNANNREHAL---RGDELHLPKVMTDT 124
            ||.|...:|.|||.||::|.|||.:|::||..|:   .:|...|....   :.:|:.:||     
Zfish    66 LFRFGRYFETPLLWQSIIMIVTMLIMLNLCTSVRMATELNTKRRSFTATDSKDEEIKVPK----- 125

  Fly   125 DTGASISTEAGGSVLKRVRSRHYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLWF 189
                                |.:| |.|:.|||:|:.|..||..:|....:.|.:|||:|..:.|
Zfish   126 --------------------RLFL-DFDWNYFWSWSRFVDYLQCVLAFTVLAAYVTYLLLDSVLF 169

  Fly   190 MESMGFVAVFTEAMLGAPQFLRNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKAPSQFWICGT 254
            :||:||:|||||||||.||...|::||||.||||.||:|||.||.||||||::.:||.||||||.
Zfish   170 VESLGFLAVFTEAMLGTPQLYCNYQNKSTEGMSIKMVLMWTSGDTFKTGYFLLTQAPMQFWICGL 234

  Fly   255 LQVSLDIAILSQVWFYRKNSKPRDLRRGDXQFAPEEQPQHIHHHDIHTSHSE 306
            |||.:|..||.||::|                  ...||....|..||:.::
Zfish   235 LQVCVDFTILFQVYYY------------------SHYPQKPISHTTHTTSAK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 34/57 (60%)
PQ-loop 193..248 CDD:282099 37/54 (69%)
pqlc1XP_021323964.1 PQ-loop 18..74 CDD:309357 33/55 (60%)
PQ-loop 173..226 CDD:309357 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583530
Domainoid 1 1.000 57 1.000 Domainoid score I10854
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004636
OrthoInspector 1 1.000 - - otm25817
orthoMCL 1 0.900 - - OOG6_103454
Panther 1 1.100 - - LDO PTHR14856
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4352
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.