DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13784 and si:dkey-246g23.2

DIOPT Version :9

Sequence 1:NP_001260176.1 Gene:CG13784 / 34003 FlyBaseID:FBgn0031897 Length:969 Species:Drosophila melanogaster
Sequence 2:XP_017207523.1 Gene:si:dkey-246g23.2 / 100003642 ZFINID:ZDB-GENE-050419-100 Length:241 Species:Danio rerio


Alignment Length:260 Identity:116/260 - (44%)
Similarity:167/260 - (64%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVGWAAASAMVIGGVIPYVPQYIEIKKTQDAEGFSLYVCLALLVANSLRILFWFSSRYELPLLVQ 80
            ::.|.|:..||.||.:||||||.||::|.:|||||..|||.||:||.|||.||...::|||||:|
Zfish    15 LLSWMASGVMVFGGAVPYVPQYQEIQRTSNAEGFSTRVCLVLLIANILRIFFWIGKQFELPLLLQ 79

  Fly    81 SVVMNVTMFLMIHLCVKVKRVNANNREHALRGDELHLPKVMTDTDTGASISTEAGGSVLKRVRSR 145
            ||||.:||..|:|||..::   ::||                       :||:           :
Zfish    80 SVVMILTMLAMLHLCCSIQ---SSNR-----------------------VSTK-----------Q 107

  Fly   146 HYLNDLDFKYFWNWTDFQSYLDFMLVVWAVGAAITYLMLSVLWFMESMGFVAVFTEAMLGAPQFL 210
            |::.|||.:|||:|:.|:.||.|......:.|.||:|.|..|.|:|::|..||..|||||.||.|
Zfish   108 HHITDLDLRYFWSWSSFEDYLMFCFAFTLLCAFITFLFLDWLLFVEALGSQAVMFEAMLGLPQLL 172

  Fly   211 RNFKNKSTYGMSIHMVIMWTLGDMFKTGYFIVRKAPSQFWICGTLQVSLDIAILSQVWFYRKNSK 275
            :|:.|:||.|||:.||::||.||:|||.||::.::|:||.:||.:|:.:|||||.||.:|.::|:
Zfish   173 QNYNNRSTRGMSVKMVLLWTAGDVFKTTYFVINESPAQFLVCGAVQILIDIAILLQVGYYGQDSR 237

  Fly   276  275
            Zfish   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13784NP_001260176.1 PQ-loop 18..76 CDD:282099 33/57 (58%)
PQ-loop 193..248 CDD:282099 30/54 (56%)
si:dkey-246g23.2XP_017207523.1 PQ-loop 17..75 CDD:282099 33/57 (58%)
PQ-loop 153..208 CDD:282099 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583531
Domainoid 1 1.000 57 1.000 Domainoid score I10854
eggNOG 1 0.900 - - E1_KOG2913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004636
OrthoInspector 1 1.000 - - otm25817
orthoMCL 1 0.900 - - OOG6_103454
Panther 1 1.100 - - O PTHR14856
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3125
SonicParanoid 1 1.000 - - X4352
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.