DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CDC34

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:45/190 - (23%)
Similarity:80/190 - (42%) Gaps:54/190 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LMKEYREMERLQAKNDAV--FTVELVNDS-LFEWHVRLHVIDPDSPLARDMAEMGVPAILLH--- 201
            |:::|||   |.....|:  |.:||.:|| :|.|::.:.|::.||              :.|   
Yeast    12 LLRQYRE---LTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDS--------------IYHGGF 59

  Fly   202 ----LSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAICMELLTPRG-----------WASAYTVEA 251
                :.||::|||:||..|.. |.|....|...|.:|:.:|...|           |:...|||:
Yeast    60 FKAQMRFPEDFPFSPPQFRFT-PAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVES 123

  Fly   252 VIMQFAASV----------VKGQGRIARKPKSTKEFTRRQAEESFRSLVKTHEKYGWVTP 301
            |::...:.:          |.......:.|:..|:..:.:.|.|.:.:.|     |::.|
Yeast   124 VLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQDIPK-----GFIMP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 37/135 (27%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 42/175 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.