DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and Ube2q1

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_081591.3 Gene:Ube2q1 / 70093 MGIID:1917343 Length:422 Species:Mus musculus


Alignment Length:208 Identity:94/208 - (45%)
Similarity:135/208 - (64%) Gaps:21/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AVWDSPGKRRRQDHKVAPTTERQLVAAPDHTIR-TRRLMKEYREMERLQAKNDAVFTVELVNDSL 170
            |:.:...|.:|||:         |..|...::: |.|||||.|::.|.|:.....:.||||||||
Mouse   228 AILEKIKKNQRQDY---------LNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSL 283

  Fly   171 FEWHVRLHVIDPDSPLARDM----AEMGVPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGG 231
            ::|:|:|..:|.||.|..|:    .:.|...|||:.||.|||||.|||:|||.|.:..|||:.||
Mouse   284 YDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGG 348

  Fly   232 AICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRI---ARKPKSTKEFTRRQAEESFRSLVKTH 293
            ||||||||.:||:|||::|:||||.:|::|||:.|:   |.|    .:::..:|::|::|||:.|
Mouse   349 AICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANK----SQYSLTRAQQSYKSLVQIH 409

  Fly   294 EKYGWVTPALSDG 306
            ||.||.||...||
Mouse   410 EKNGWYTPPKEDG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 66/121 (55%)
Ube2q1NP_081591.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..221
UBCc 253..409 CDD:238117 78/159 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.