DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CG14739

DIOPT Version :10

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:160 Identity:37/160 - (23%)
Similarity:67/160 - (41%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 REMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFPDNFPFAP 212
            |::.||.|.....    .|:|.:...:|.|     :.||. ...|.|:..:  :::.|.::|...
  Fly    20 RDVNRLLASGYRT----TVDDDMTNLNVCL-----EGPLG-SAYEGGIWTV--NVTMPQDYPLTA 72

  Fly   213 PFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAASVVKGQGRIARKPKS 273
            |.:|    ::.|:||  ::.  |.:||.:| .:.|:|:|.:..:...|..       ::.|.|..
  Fly    73 PRVRFVTKILHPNIE--FIT--GLVCMNVL-KQAWSSSYDLVNIFETFLP-------QLLRYPNP 125

  Fly   274 TKEFTRRQA------EESFRSLV----KTH 293
            ......|.|      |:.||..|    ||:
  Fly   126 HDSLNHRAAAIMKHSEQLFREHVILCMKTY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc_UBE2Q 141..293 CDD:467422 36/158 (23%)
CG14739NP_650151.1 UBCc_UBE2H 16..152 CDD:467417 35/155 (23%)

Return to query results.
Submit another query.