DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CG17030

DIOPT Version :10

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:60/138 - (43%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ERQLVAAPDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMA 191
            |..|:..|....|...||.|  :.:.||.:|   ..||  .:::::|...|..:.|  |..:.  
  Fly     5 EEPLMDGPKRMNRELALMLE--DKQNLQFRN---LLVE--PNNIYKWTGLLMPVAP--PYDKG-- 58

  Fly   192 EMGVPAILLHLSFPDNFPFAPPFMRVVEPHIE-KGY---VMEGGAICMELLTPRGWASAYTVEAV 252
                 |..:.:.||.::||.||  |:   ||. :.|   |.|.|.:|:.:|....|.....::.|
  Fly    59 -----AYKMEIDFPLDYPFKPP--RI---HINTRMYHLNVNERGQVCVPILEVEHWIPTTRIDQV 113

  Fly   253 IMQFAASV 260
            :....|::
  Fly   114 LQVLLATI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc_UBE2Q 141..293 CDD:467422 31/124 (25%)
CG17030NP_647941.1 UBCc_UBE2L3 11..158 CDD:467421 33/132 (25%)

Return to query results.
Submit another query.