DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CG17030

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:58/136 - (42%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ERQLVAAPDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMA 191
            |..|:..|....|...||.|  :.:.||.:|   ..||  .:::::|...|..:.|  |..:.  
  Fly     5 EEPLMDGPKRMNRELALMLE--DKQNLQFRN---LLVE--PNNIYKWTGLLMPVAP--PYDKG-- 58

  Fly   192 EMGVPAILLHLSFPDNFPFAPPFMRVVEP--HIEKGYVMEGGAICMELLTPRGWASAYTVEAVIM 254
                 |..:.:.||.::||.||.:.:...  |:.   |.|.|.:|:.:|....|.....::.|:.
  Fly    59 -----AYKMEIDFPLDYPFKPPRIHINTRMYHLN---VNERGQVCVPILEVEHWIPTTRIDQVLQ 115

  Fly   255 QFAASV 260
            ...|::
  Fly   116 VLLATI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 27/119 (23%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 30/129 (23%)
UQ_con 14..153 CDD:278603 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.