DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and Ubc10

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:167 Identity:35/167 - (20%)
Similarity:73/167 - (43%) Gaps:44/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RRLMKEYREME--RLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDMAEMGVPAILLHLS 203
            |||.||..:::  .|::..|    ::..:|:|..|   ..:|.||:|      .....|..:.::
  Fly     5 RRLRKELSDLQGNALKSFRD----IKADDDNLLRW---TGLIVPDNP------PYNKGAFRIEIN 56

  Fly   204 FPDNFPFAPPFM----RVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIM---------- 254
            ||..:||.||.:    |:..|:|:     |.|.:|:.:::...|..|...:.|:.          
  Fly    57 FPAEYPFKPPKINFKTRIYHPNID-----EKGQVCLPIISTENWKPATRTDQVVQALVDLINDPE 116

  Fly   255 -------QFAASVVKGQGRIARKPKSTKEFTRRQAEE 284
                   :.|...:|.:.:..   |:.:::|::.:|:
  Fly   117 PEHPLRAELAEEFLKDRKKFV---KNAEDYTKKHSEK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 30/139 (22%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.