DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CG3473

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:124 Identity:30/124 - (24%)
Similarity:53/124 - (42%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDP-DSPLARDMAEMGVPAILLHLS 203
            |.|::||.:.:     ..|.|..:....|.....:..:.|..| |||.     |.|  ...|.|.
  Fly     5 TPRIIKETQRL-----LEDPVPGISATPDECNARYFHVLVTGPKDSPF-----EGG--NFKLELF 57

  Fly   204 FPDNFPFAPPFMR----VVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAA 258
            .|:::|...|.:|    :..|:|::     .|.||:::|..: |:.|..:..|::...|
  Fly    58 LPEDYPMKAPKVRFLTKIFHPNIDR-----VGRICLDILKDK-WSPALQIRTVLLSIQA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 29/122 (24%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 30/124 (24%)
COG5078 7..149 CDD:227410 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.