DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and CG2574

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster


Alignment Length:134 Identity:30/134 - (22%)
Similarity:55/134 - (41%) Gaps:10/134 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KVAPTTERQLVAAPDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSP 185
            :.||:|.............|..:::...|::.::.......|.:|.:..|..|...:     :.|
  Fly    42 ETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGV-----NGP 101

  Fly   186 LARDMAEMGVPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVE 250
            :. .:.|.|  ...|.:.||.::||..|.:|.. ..|....|...||||:::|..| |:....|.
  Fly   102 VG-SVYEGG--HFRLDIRFPASYPFRAPRIRFT-TRIYHCNVDSRGAICLDVLGER-WSPVMNVA 161

  Fly   251 AVIM 254
            .|::
  Fly   162 KVLL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 27/115 (23%)
CG2574NP_572796.1 COG5078 66..208 CDD:227410 26/110 (24%)
UQ_con 66..203 CDD:278603 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.