DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and AA414768

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001258962.1 Gene:AA414768 / 245350 MGIID:3035137 Length:387 Species:Mus musculus


Alignment Length:242 Identity:99/242 - (40%)
Similarity:142/242 - (58%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GGVAVAGGAVGSSGSSGAAKNAVVRMAAEQ--------AVWDSPGKRRRQDHKVAPTTERQLVAA 133
            ||    ||..|..|.....:.|.....:|.        |:.::..|.:||:|.      ...|:.
Mouse   159 GG----GGGGGGGGEEEEEEEASSEKKSEDEGLEKEHLAILENIKKSQRQEHL------NGTVSG 213

  Fly   134 PDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHVRLHVIDPDSPLARDM----AEMG 194
            ..|.  :.|||||.|::.|.|:.....::|||:||||::|||:|..:||||||..|:    .:.|
Mouse   214 SVHA--SNRLMKELRDIYRSQSYKSGTYSVELINDSLYDWHVKLRKVDPDSPLYGDLQLLNEKEG 276

  Fly   195 VPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAICMELLTPRGWASAYTVEAVIMQFAAS 259
            :..|||:.||.|||||.|||:||..|.:..|||:.|||:||||||.:||:|||::|:||||..|:
Mouse   277 IDYILLNFSFKDNFPFDPPFVRVELPILSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINAT 341

  Fly   260 VVKGQGRIARKPKSTKEFTRRQAEESFRSLVKTHEKYGWVTPALSDG 306
            :|||:.|: |......::....|::|:.|:|:.|||.||.||...||
Mouse   342 LVKGKARV-RFGADKNQYNLETAQQSYDSVVQMHEKKGWFTPPKEDG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 65/121 (54%)
AA414768NP_001258962.1 RWD 8..>87 CDD:283440
UBCc 218..>343 CDD:238117 66/124 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.