DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4502 and UBE2QL1

DIOPT Version :9

Sequence 1:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_024310129.1 Gene:UBE2QL1 / 134111 HGNCID:37269 Length:267 Species:Homo sapiens


Alignment Length:266 Identity:131/266 - (49%)
Similarity:166/266 - (62%) Gaps:27/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GATGSSPNINNNNNNNNNNNNHDGAAAPSSAGGVAVAGGAVGSSGSSGAAKNAVVRMAAEQAVWD 110
            ||..:||      .............||......|.|..|..::|:.|..:.|.           
Human    24 GAGDASP------GPGKGKGKRAAELAPRDKAPAAAAAAAAAAAGAGGPRERAA----------- 71

  Fly   111 SPGKRRRQDHKVAPTTERQLV--AAPDH--TIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLF 171
              |.|......||......||  |...|  .:|:||||||.:::.||   :|...:||||::|||
Human    72 --GARAGPGPAVAAAAGGSLVPAARQQHCTQVRSRRLMKELQDIARL---SDRFISVELVDESLF 131

  Fly   172 EWHVRLHVIDPDSPLARDMAEMGVPAILLHLSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAICME 236
            :|:|:||.:|.||.|.:||.|.....|||:|:|||||||:||||||:.|.:|.|||::|||||||
Human   132 DWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICME 196

  Fly   237 LLTPRGWASAYTVEAVIMQFAASVVKGQGRIARKP-KSTKEFTRRQAEESFRSLVKTHEKYGWVT 300
            |||||||:||||||||:.|||||:|||||||.||. ||.|.|:|::||.:|:|||||||||||||
Human   197 LLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVT 261

  Fly   301 PALSDG 306
            |.:|||
Human   262 PPVSDG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 73/117 (62%)
UBE2QL1XP_024310129.1 UBCc 103..>221 CDD:238117 76/120 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159337
Domainoid 1 1.000 149 1.000 Domainoid score I4408
eggNOG 1 0.900 - - E1_KOG0897
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15975
Inparanoid 1 1.050 220 1.000 Inparanoid score I3562
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214134at2759
OrthoFinder 1 1.000 - - FOG0008145
OrthoInspector 1 1.000 - - oto88764
orthoMCL 1 0.900 - - OOG6_109648
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4130
SonicParanoid 1 1.000 - - X6105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.