DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and Sry-delta

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:428 Identity:92/428 - (21%)
Similarity:141/428 - (32%) Gaps:124/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VVAEIELSDSDHDEDSEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVPSDQEDEQKTDN-- 218
            :|.|:|:..||.:.|::.:.|.....     ::.:|.:..::..:|.|     |:|:|:..|:  
  Fly   107 LVEEVEIPQSDVETDADAEADALFVE-----LVKDQEESDTEIKREFV-----DEEEEEDDDDDD 161

  Fly   219 --------------VIKRKSSGSRRLVKRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMIHTG 269
                          :..:.|.|..|..|:|.        ..||..|||...|.|.|::|:     
  Fly   162 EFICEDVDVGDSEALYGKSSDGEDRPTKKRV--------KQECTTCGKVYNSWYQLQKHI----- 213

  Fly   270 ERPFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGAPLEQDSTRCADCESKNLMVKPQPE 334
                                  ...||..|..||.||.:   :.:|                   
  Fly   214 ----------------------SEEHSKQPNHICPICGV---IRRD------------------- 234

  Fly   335 ELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQSPPEKVPSHTQPSRPP 399
               |:..|.|.:..||          :.|||.:..          |...|.|.....|.:.....
  Fly   235 ---EEYLELHMNLHEG----------KTEKQCRYC----------PKSFSRPVNTLRHMRMHWDK 276

  Fly   400 LPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYP--CPLCHRPFGTRHNLKRHYMIHTGEKP-FSC 461
            ....|...  ....|.|..:....:.......|  |.:|:..|.:|.....|.:||...:| ..|
  Fly   277 KKYQCEKC--GLRFSQDNLLYNHRLRHEAEENPIICSICNVSFKSRKTFNHHTLIHKENRPRHYC 339

  Fly   462 SKCRKPFRECSTLKKHMVTHVRDRWYKCL-RCPSKFRDYLEYSDHKNNHQDQLSSRKS-SIYESD 524
            |.|.|.|.|..|||.||.||..|..|... ..|:..:..:|     ..|.|...|..: ::..||
  Fly   340 SVCPKSFTERYTLKMHMKTHEGDVVYGVREEAPADEQQVVE-----ELHVDVDESEAAVTVIMSD 399

  Fly   525 DDGDSSVEDCLECCECQQRFTELDAYTAHLK-KHDLEL 561
            :|.:|..     |..|...|........||: .||:.|
  Fly   400 NDENSGF-----CLICNTNFENKKELEHHLQFDHDVVL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 9/21 (43%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
zf-H2C2_2 259..282 CDD:290200 2/22 (9%)
C2H2 Zn finger 275..295 CDD:275368 0/19 (0%)
zf-C2H2 431..453 CDD:278523 6/23 (26%)
C2H2 Zn finger 433..453 CDD:275368 5/19 (26%)
zf-H2C2_2 445..468 CDD:290200 8/23 (35%)
C2H2 Zn finger 461..481 CDD:275368 11/19 (58%)
C2H2 Zn finger 489..510 CDD:275368 2/21 (10%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 48/228 (21%)
C2H2 Zn finger 225..245 CDD:275368 7/44 (16%)
C2H2 Zn finger 253..273 CDD:275368 4/29 (14%)
C2H2 Zn finger 281..301 CDD:275368 3/21 (14%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 11/21 (52%)
C2H2 Zn finger 339..359 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.