DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and Sry-beta

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:411 Identity:78/411 - (18%)
Similarity:119/411 - (28%) Gaps:175/411 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IGQQQREKELEIKRIMEQEKREK--------------REKERREAEKRRDQEVIE---LDEEEAQ 119
            :|.:|.|.:.|.|:  :..||.:              :|.||:..|:...:|.::   |||    
  Fly    88 LGCRQVEGKAETKQ--QAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDE---- 146

  Fly   120 SPRGLIISAARSLAHWNSSIRRVTPDIELIPRRVHRVVAEIELSDSDHDEDSEVDEDVSLPSNAV 184
                                                   |.:.|:.| |.....:|:....:..:
  Fly   147 ---------------------------------------EFQFSEPD-DSMPSSEEEFFTETTEI 171

  Fly   185 SC-VLNEQRQDGSQNPQELVIIVPSDQEDEQKTDNV--IKRKSSGSRRLVKRRPGANRRGRHMYE 246
            .| :..|  ...||...|..|...:.|:.||.|.||  :|.|......|....    ..|:...|
  Fly   172 PCHICGE--MFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNL----HEGKTELE 230

  Fly   247 CPDCGKKVQSNYNLRRHMMIHTGERPFPCDLCERRFREFSDLKKHRRRH-SHDPQFICMICHLGA 310
            |..|.||.....|:.|||.:|..::.:.||.|..||.....:..|..|| :.:...||.:||   
  Fly   231 CRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCH--- 292

  Fly   311 PLEQDSTRCADCESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLM 375
                                   ::...|.|.:|                               
  Fly   293 -----------------------QQFKTKRTYKH------------------------------- 303

  Fly   376 VTLIPPIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPF 440
                            |.:..:...||                            ||||.|.:.|
  Fly   304 ----------------HLRTHQTDRPR----------------------------YPCPDCEKSF 324

  Fly   441 GTRHNLKRHYMIHTG-EKPFS 460
            ..::.||.|..:|.. |||.|
  Fly   325 VDKYTLKVHKRVHQPVEKPES 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 9/21 (43%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
zf-H2C2_2 259..282 CDD:290200 8/22 (36%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-C2H2 431..453 CDD:278523 9/21 (43%)
C2H2 Zn finger 433..453 CDD:275368 7/19 (37%)
zf-H2C2_2 445..468 CDD:290200 8/17 (47%)
C2H2 Zn finger 461..481 CDD:275368 78/411 (19%)
C2H2 Zn finger 489..510 CDD:275368
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/23 (22%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
C2H2 Zn finger 259..308 CDD:275368 16/121 (13%)
C2H2 Zn finger 288..303 CDD:275370 5/40 (13%)
zf-C2H2 315..337 CDD:278523 9/21 (43%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.