DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and CG4424

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:296 Identity:69/296 - (23%)
Similarity:111/296 - (37%) Gaps:76/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 PQFICMICHLGAPLEQDSTRCADCESKN-----LMVKPQPE-----ELGEKTTEE-----HSDEM 348
            |..||:.|.....|.....:.  |:..|     .::|...|     |:.::|...     .::::
  Fly    61 PTRICLRCKAFLTLAHKFRQI--CQRSNEFLREYVIKDAVEQGVVKEVVQQTRPSTPPPIETEQL 123

  Fly   349 EGDDDEIEEAALENEKQPQVAT--------QPSLMVTLIPPIQSPPEKVPSHTQPSRPP------ 399
            |..:||:.|..:.:.:.|...|        :|:::...:.|...||   |:.|.|..|.      
  Fly   124 EPPEDEVLEEGVWSTEDPIEETPHGPAEKERPTVLTVEMLPAPYPP---PASTPPPAPAGAVKGK 185

  Fly   400 ----------LPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNLKRHYMIHT 454
                      .||. |:.::.....||           .|.|.|.:||:.|...:.||||...||
  Fly   186 LHVCAICGNGYPRK-STLDTHMRRHND-----------ERPYECEICHKSFHVNYQLKRHIRQHT 238

  Fly   455 GEKPFSCSKCRKPFRECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDHKNNHQDQLSSRKSS 519
            |.||::|..|::.|.:.::|.||..||..:|.|.|..|..||    .|:.....|....:..|..
  Fly   239 GAKPYTCQYCQRNFADRTSLVKHERTHRNERPYACKTCGKKF----TYASVLKMHYKTHTGEKPH 299

  Fly   520 IYESDDDGDSSVEDCLECCECQQRFTELDAYTAHLK 555
            |                |..|.:.|..:....|||:
  Fly   300 I----------------CQLCNKSFARIHNLVAHLQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523
C2H2 Zn finger 247..267 CDD:275368
zf-H2C2_2 259..282 CDD:290200
C2H2 Zn finger 275..295 CDD:275368
zf-C2H2 431..453 CDD:278523 9/21 (43%)
C2H2 Zn finger 433..453 CDD:275368 8/19 (42%)
zf-H2C2_2 445..468 CDD:290200 11/22 (50%)
C2H2 Zn finger 461..481 CDD:275368 6/19 (32%)
C2H2 Zn finger 489..510 CDD:275368 5/20 (25%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071 7/32 (22%)
C2H2 Zn finger 189..209 CDD:275368 3/20 (15%)
DUF45 <204..281 CDD:302795 31/91 (34%)
COG5048 210..>345 CDD:227381 41/141 (29%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
zf-H2C2_2 257..282 CDD:290200 11/28 (39%)
C2H2 Zn finger 273..293 CDD:275368 6/23 (26%)
zf-H2C2_2 286..310 CDD:290200 6/39 (15%)
C2H2 Zn finger 301..320 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.