DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and CG3281

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:584 Identity:101/584 - (17%)
Similarity:171/584 - (29%) Gaps:279/584 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EYQEPEENFISIDDVKIKSFLWQIGQQQREKELEIKRIMEQEKREKREKERREAEKRRDQEVIEL 113
            ::.|.||.:   .|....:|...:|::.         :...|.|:...::..:.:.|.|    |:
  Fly   132 QHVEMEEKY---GDQDCSAFTSDVGEEP---------LYASEDRDDEPEDSFQLKPRPD----EI 180

  Fly   114 DEEEAQSPRGL-------------------IISAARSLAHWNSSIRRVTPDIELIPRRVHRVVAE 159
            :..|...|..|                   :.:.:.||....|...::|.|           ||.
  Fly   181 ENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKSESLTRHFSQAHKLTAD-----------VAA 234

  Fly   160 IELSDS---------DHDEDSEVDEDVSLPSNAVSCVLNEQRQDGSQ------NPQELVIIVPSD 209
            ::|::.         :|                  |....:|||..:      :|..:.:     
  Fly   235 MKLANESCGTGLLTCEH------------------CPRTFKRQDTLRRHMQAFHPDAIAL----- 276

  Fly   210 QEDEQKTDNVIKRKSSGSRRLVKRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMIHTGERPFP 274
             |.|:.|||      |..:|:.|||           :||.||.....: :|..|:..|||:.|:.
  Fly   277 -EPEETTDN------SARKRIAKRR-----------DCPHCGLSFPVS-SLTIHIRRHTGDNPYK 322

  Fly   275 CDLCERRFREFSDLKKHRRRHSHDPQFICMICHLGAPLEQDSTRCADCESKNLMVKPQPEELGEK 339
            ||.||:.|....||..|.|:|:                                        ||:
  Fly   323 CDQCEKAFPRSQDLSLHMRQHT----------------------------------------GER 347

  Fly   340 TTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQSPPEKVPSHTQPSRPPLPRSC 404
            .:|                                                              
  Fly   348 PSE-------------------------------------------------------------- 350

  Fly   405 SSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNLKRHYMIHTGEKPFSCSKCRKPFR 469
                                        |.:|.:.|.:::.|.||..:|||::|:||..|.|.|.
  Fly   351 ----------------------------CKICSKKFISQNKLARHMRLHTGQRPYSCKMCSKSFV 387

  Fly   470 ECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDHKNNHQD----------------------- 511
            :.:.||.||..|..:|.|:|..|...|    ....|.|.|::                       
  Fly   388 QSNDLKIHMRRHTGERPYQCGVCGESF----VCGSHLNIHRNRKGHLIAVIPGNEVEANFAADPY 448

  Fly   512 ---QLSSRKSSIYE-------SDDDGDSSVED---------CLECCECQQRFTELDAYTAHLKK 556
               :::.|:|...|       .::.....:|:         |.:|..|:|:|......|.|..|
  Fly   449 VNARVNQRRSEDIERMRLQRIPENQLQQRLENLPKPDVPAMCYKCGVCEQKFKSGALLTVHRNK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 6/21 (29%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
zf-H2C2_2 259..282 CDD:290200 10/22 (45%)
C2H2 Zn finger 275..295 CDD:275368 9/19 (47%)
zf-C2H2 431..453 CDD:278523 6/21 (29%)
C2H2 Zn finger 433..453 CDD:275368 6/19 (32%)
zf-H2C2_2 445..468 CDD:290200 11/22 (50%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
C2H2 Zn finger 489..510 CDD:275368 5/20 (25%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071
C2H2 Zn finger 205..226 CDD:275368 3/20 (15%)
C2H2 Zn finger 249..266 CDD:275368 5/34 (15%)
COG5048 <294..>391 CDD:227381 39/238 (16%)
C2H2 Zn finger 296..315 CDD:275368 6/19 (32%)
zf-H2C2_2 307..330 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 10/152 (7%)
C2H2 Zn finger 351..371 CDD:275368 6/19 (32%)
zf-H2C2_2 364..388 CDD:290200 12/23 (52%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
zf-H2C2_2 391..416 CDD:290200 10/28 (36%)
C2H2 Zn finger 407..424 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.