DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and CG1024

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:530 Identity:101/530 - (19%)
Similarity:155/530 - (29%) Gaps:220/530 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 RPGANRRGRHMYECPDCGKKVQSNYNLRRHM---------------MIHTGERPFPCDLC----E 279
            |..|......:|.||:|||..::....|:|:               .|...||...|.||    |
  Fly    17 RLNARLEAHMVYICPECGKAFRTQAEWRQHLNTKHDYLKKTYSDFNFIQIDERFHECQLCFKWVE 81

  Fly   280 RRFREFSDLKKHRRRH-SHDPQFICMIC------------HL----------------------- 308
            ...:..:.|:.|...| .|...:.|:.|            ||                       
  Fly    82 NAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHLLDTHMREIEKYENKLRQMKRQQA 146

  Fly   309 ---------------------GAPLEQDSTRCADCESKNLM--------------------VKPQ 332
                                 |.|....:.:..|...|.||                    .:|:
  Fly   147 KPTTAAAPAGNAEKPMAVKPRGRPKGSTNRKQNDLLQKALMDIDLNTEMEKSPVTALAAPVNEPK 211

  Fly   333 P----------------EELGEKTTEE----HSDEMEG------DD------DEIEEAALENEKQ 365
            |                |::..|..:|    :.||::.      ||      .|..|...:::..
  Fly   212 PISNVSELNLDRCLNAYEDIVRKEEKEVVPKYDDELDALCKEFFDDGPSAGKGEANEEQQQDDAH 276

  Fly   366 PQVATQPSLMVTL----------------IPPIQSPPEKVPSHTQPSRPPLPRSCSSANSSSSLS 414
            .|...|..:::.:                ..||..|.::....|.|||          :|.:.:|
  Fly   277 LQQGNQEVVIIEIDALGKEEVAQLKKEMKSDPISQPTKRRRISTTPSR----------DSDTEMS 331

  Fly   415 NDGNIAGKSMSRTRR-SYPCPLCHRPFGT-----RHNLKRHYMIHTGEKPFS---------CSKC 464
            .:|        .|:. ||.||.|.:...:     .|..|:|...|..|..|.         |.:|
  Fly   332 TNG--------LTKLISYLCPKCGKEIASMDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQC 388

  Fly   465 R--KPFRECSTLKKHMVTHVRDRWY-KCLRC------PSKFRDYLEYSDHKNNHQDQL------- 513
            |  :|....|.|:||...|:..|.| ||..|      .||..:::.|     |||::|       
  Fly   389 REVQPTTVRSQLQKHCFKHLPYRSYLKCTLCDRTKTSTSKILNHIRY-----NHQEELQRKNKTQ 448

  Fly   514 ----------SSRKS-------SIYESDDDGDSSVEDCLECCECQQRFTELDAYTAHLKKHDLEL 561
                      |..||       .....||.|:.:|     |..|.:.|.....|..|:.......
  Fly   449 LLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQAV-----CEHCDRVFRSKWRYERHIASCRRSG 508

  Fly   562 YGMSIDDVAD 571
            .|.|::...:
  Fly   509 AGKSVEGTVE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 8/36 (22%)
C2H2 Zn finger 247..267 CDD:275368 7/34 (21%)
zf-H2C2_2 259..282 CDD:290200 9/41 (22%)
C2H2 Zn finger 275..295 CDD:275368 6/23 (26%)
zf-C2H2 431..453 CDD:278523 7/26 (27%)
C2H2 Zn finger 433..453 CDD:275368 6/24 (25%)
zf-H2C2_2 445..468 CDD:290200 8/33 (24%)
C2H2 Zn finger 461..481 CDD:275368 8/21 (38%)
C2H2 Zn finger 489..510 CDD:275368 6/26 (23%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 7/20 (35%)
C2H2 Zn finger 73..100 CDD:275368 7/26 (27%)
C2H2 Zn finger 106..123 CDD:275368 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.