DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and CG31612

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster


Alignment Length:719 Identity:135/719 - (18%)
Similarity:226/719 - (31%) Gaps:244/719 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QEPEENFI--SIDDVKIKSFLWQIGQQQRE-----------------------KELEIKRIMEQE 90
            :.||||:.  ..|..|.|   |..|.:|.|                       :.|:.:....|.
  Fly   240 EPPEENYTHPPADHTKGK---WVPGSKQLEYRENLDLTKLDQPGASYWCNICCRRLKSRLYYNQH 301

  Fly    91 KREKREKERREAEKRRDQEVI--------------ELDEEEAQSP----RGLII-------SAAR 130
            .|.....:|.|||...:|..:              :.|:.|.:.|    |..::       :.||
  Fly   302 LRSGYHIKRAEAECELEQATLGRELTLSKDFSIKDDADKNEPKPPKRQRRANLLRCDLCRHTMAR 366

  Fly   131 SL------AHWN-----------------------SSIRRVTPDIELIPRRVHRVVAEIELSDSD 166
            .|      :|::                       .||.|.:| .:.:|.|.:....|..|....
  Fly   367 HLIGKHLISHYHFRRLQQQSRIRRQACLQEILKHMGSIVRQSP-FQCMPCRFYANTEETFLYHWK 430

  Fly   167 HDEDSEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVPSDQEDEQKTDNVIKRKSSGSRRLV 231
            ..|..|:.:.:........|..|    ..:.|...|.::..|.:|.....:..:....:..||: 
  Fly   431 SHEHLELTKRLGGTFWCSFCQFN----SNTNNSMLLHLLDSSHKEVLLALNRSVPICIAQRRRI- 490

  Fly   232 KRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMI-HTG-----------ERPFPCDLCERRFRE 284
                          :|..||.:...|..||:|.:. |.|           :..|.|:||....:.
  Fly   491 --------------QCSRCGMEFLYNIQLRQHSITEHPGLALTGTAADEYQSRFRCNLCGSSQKS 541

  Fly   285 FSDLKKHRRRHSHDPQFICMICHLGAPLEQDSTRCADCESKNLMVK----------PQPE----- 334
            ...|::|::...|..::.|.||.|......|:.|     .::|::.          ||||     
  Fly   542 RLALQRHKKHKHHLARYFCAICRLEFDNSLDARR-----HRSLVIHKQKARPQTSIPQPENEIEH 601

  Fly   335 ---ELGEKTTEEHSDEMEGDDD--------EIEEAALENEKQPQVATQPSLMVTLIPPIQSPPEK 388
               |:.|:|......:...|.:        .||.:....:.|.:|.:..:.:...........:.
  Fly   602 MLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQA 666

  Fly   389 VPSHTQPSRP----PLPRSCSSANSSSSLSND---------GNIAGKSMSRTRRS-------YPC 433
            :..||:..:|    ..|...|.|...|..|.|         .::....:..||..       ..|
  Fly   667 LGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQC 731

  Fly   434 PLCHRPFGTRHNLKRHYMIHTGEKPFSCSKC---------------------------------- 464
            |||.:.| .:|:|:.|...||.||.|.|::|                                  
  Fly   732 PLCPKNF-KKHSLRAHLRNHTNEKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAKDV 795

  Fly   465 --RKPFRECST----------LKKHMVTHVR--DRWYKCL--------RCPSKFRDYLEYSDHKN 507
              .||..:|.|          ||.|.::|.:  :|.|.|.        |.|...:.:| .|..:.
  Fly   796 EQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHL-VSHSQE 859

  Fly   508 NH-------------QDQLSSRKSSIYESDDDGDSSVEDCLECCECQQRFTELDAYTAHLKKHDL 559
            ||             :..|.....|.:.::.:|    |:...|.:|..|    .....||::|.|
  Fly   860 NHKCARINCSYVGKSELHLKRHLKSAHSTEKNG----EEWFSCDQCDFR----ARIKGHLRRHSL 916

  Fly   560 ELYG 563
            ...|
  Fly   917 RHSG 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 7/22 (32%)
C2H2 Zn finger 247..267 CDD:275368 7/20 (35%)
zf-H2C2_2 259..282 CDD:290200 9/34 (26%)
C2H2 Zn finger 275..295 CDD:275368 5/19 (26%)
zf-C2H2 431..453 CDD:278523 8/21 (38%)
C2H2 Zn finger 433..453 CDD:275368 8/19 (42%)
zf-H2C2_2 445..468 CDD:290200 10/58 (17%)
C2H2 Zn finger 461..481 CDD:275368 9/65 (14%)
C2H2 Zn finger 489..510 CDD:275368 7/41 (17%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 1/19 (5%)
C2H2 Zn finger 731..750 CDD:275368 8/19 (42%)
C2H2 Zn finger 758..779 CDD:275368 2/20 (10%)
C2H2 Zn finger 804..824 CDD:275368 5/19 (26%)
C2H2 Zn finger 834..856 CDD:275368 4/22 (18%)
C2H2 Zn finger 898..918 CDD:275368 7/23 (30%)
zf-H2C2_2 910..935 CDD:290200 5/11 (45%)
C2H2 Zn finger 926..945 CDD:275368
C2H2 Zn finger 957..984 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.