DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and CG12299

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:670 Identity:137/670 - (20%)
Similarity:213/670 - (31%) Gaps:242/670 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LIP---PDPVRYEYQEPEENFISIDDVKIKSF------LWQIGQQQREKELEIKRIMEQEKREKR 95
            |:|   |:|.:.:.|:|:...::...:....|      |:|          .:..:...|....:
  Fly    25 LLPQQAPNPPQQQPQQPQPPDLTFHCMCCAEFFVHPLALYQ----------HMNTLHPHEPGNGQ 79

  Fly    96 EKERREAEKRRD-----QEVIELDEEEAQSPRGLIISAARSLAHWNSSIRRVTPDIELIPRRVHR 155
            :::....::..|     :.|.||.|:.:.|..|...|.:.|    :||                 
  Fly    80 QEQESPGDESEDYSWIFEPVCELAEDGSDSSDGSASSGSDS----SSS----------------- 123

  Fly   156 VVAEIELSDSDHDED-------SEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVPSDQEDE 213
                   ||.|.|:|       |....:.|..|::|....|...|...::.|.|..:|.....:|
  Fly   124 -------SDDDDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLHGLVAGPGYNE 181

  Fly   214 ---QKTDNVIKRKSSG------------------------------SRRLVKRR----------- 234
               |.||   .|:|:.                              |..:.:||           
  Fly   182 FQLQMTD---PRESTSIFMVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRGRRSNIGAPVM 243

  Fly   235 --------------------PGANRRGRHM--------YECPDCGKKVQSNYNLRRHMMIHTGER 271
                                |.|....:|:        ::|..|.|......:|..|:.||:||:
  Fly   244 DPALNGNQKCFQCTHCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEK 308

  Fly   272 PFPCDLCERRFREFSDLKKHRRRHSHDPQFICMICHLG---------------APLEQDSTRCAD 321
            |:.|:||.:.|.:.|.|..|.|.||......|:.|..|               ||.|  :..|.:
  Fly   309 PYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTE--TFICPE 371

  Fly   322 CESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQSPP 386
            ||.         |...|...:||                                          
  Fly   372 CER---------EFKAEALLDEH------------------------------------------ 385

  Fly   387 EKVPSHTQPSRPPLPRSCSSAN-----SSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNL 446
              :..|||    .|...|:...     ||..:.:..|..|:      :.:.|.||.|.|....:|
  Fly   386 --MRMHTQ----ELVYQCAICREAFRASSELVQHMKNHMGE------KPFTCSLCDRSFTQSGSL 438

  Fly   447 KRHYMIHTGEKPFSCSKCRKPFRECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDHKNNHQD 511
            ..|..||||||||.|..|.|.|.:.|:|..||..|..::.|.|..|...:......:.|...|  
  Fly   439 NIHMRIHTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAH-- 501

  Fly   512 QLSSRKSSIYESDDDG---DSSVEDCLECCECQQRFTELDAYTAHLKKHDLELY----------- 562
            |::|..|:   |...|   .....:.|.|..|.....:..|..:|:......|.           
  Fly   502 QMASAASA---STSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLDTMKQSGMNTA 563

  Fly   563 -GMSIDDV---ADEEQDDVD 578
             |.:|.||   |:|:|..|:
  Fly   564 PGGAIPDVKCSAEEQQAYVE 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 5/21 (24%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
zf-H2C2_2 259..282 CDD:290200 10/22 (45%)
C2H2 Zn finger 275..295 CDD:275368 8/19 (42%)
zf-C2H2 431..453 CDD:278523 7/21 (33%)
C2H2 Zn finger 433..453 CDD:275368 7/19 (37%)
zf-H2C2_2 445..468 CDD:290200 13/22 (59%)
C2H2 Zn finger 461..481 CDD:275368 8/19 (42%)
C2H2 Zn finger 489..510 CDD:275368 3/20 (15%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 43/217 (20%)
C2H2 Zn finger 256..276 CDD:275368 3/19 (16%)
zf-H2C2_2 268..293 CDD:290200 4/24 (17%)
C2H2 Zn finger 284..304 CDD:275368 5/19 (26%)
zf-H2C2_2 296..321 CDD:290200 11/24 (46%)
zf-C2H2_2 312..>387 CDD:289522 23/129 (18%)
C2H2 Zn finger 312..332 CDD:275368 8/19 (42%)
C2H2 Zn finger 340..360 CDD:275368 3/19 (16%)
C2H2 Zn finger 369..389 CDD:275368 7/72 (10%)
C2H2 Zn finger 397..417 CDD:275368 3/19 (16%)
zf-H2C2_2 409..434 CDD:290200 7/30 (23%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..462 CDD:290200 14/24 (58%)
C2H2 Zn finger 453..473 CDD:275368 8/19 (42%)
zf-H2C2_2 465..490 CDD:290200 7/24 (29%)
C2H2 Zn finger 481..501 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.