DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4496 and Opbp

DIOPT Version :9

Sequence 1:NP_001285707.1 Gene:CG4496 / 34000 FlyBaseID:FBgn0031894 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:442 Identity:93/442 - (21%)
Similarity:145/442 - (32%) Gaps:142/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 VHRVVAEIELSDSDHDEDSEVDEDVSLPSNAVSCVLNEQRQDGSQNPQELVIIVP-------SDQ 210
            |..|.|.:: ::.|.:|.|..|.......:::.    |.|....::      |.|       |.|
  Fly    95 VEEVPANVK-AEKDQNEPSNSDRYFCYDCHSIF----ENRNKAEEH------ICPRAESGGSSQQ 148

  Fly   211 EDEQKTDNVIKRKSSGSRRLVKRRPGANRRGRHMYECPDCGKKVQSNYNLRRHMMIHTGERP--- 272
            :.:.|..  ::||.:.    |..|.|. |....:..|..|.....|...|:.||.||....|   
  Fly   149 DGDAKAP--VRRKLAS----VSARTGP-RDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSI 206

  Fly   273 -----------------FPCDLCERRFREFSDLKKHRRRHSHD-PQFICMICHLGAPLEQDSTRC 319
                             |.|::|.:.|.| :.|..|::.|..: .:.:|.||:            
  Fly   207 QDALPIGAHQQYSELDQFYCEICNKSFDE-TLLTVHKQMHQQESSEIMCSICN------------ 258

  Fly   320 ADCESKNLMVKPQPEELGEKTTEEHSDEMEGDDDEIEEAALENEKQPQVATQPSLMVTLIPPIQS 384
                                                  ...|||...|:.             |.
  Fly   259 --------------------------------------RKFENEVTYQMH-------------QK 272

  Fly   385 PPEKVPSHTQPSRPPLPRSCSSANSSSSLSNDGNIAGKSMSRTRRSYPCPLCHRPFGTRHNLKRH 449
            ..|| |..::.||....|:                   |:.:.:..:||..|.|.|.......:|
  Fly   273 IHEK-PRDSESSRKLAQRT-------------------SLDKEKPGFPCQYCERVFTRPFEKVKH 317

  Fly   450 YMIHTGEKPFSCSKCRKPFRECSTLKKHMVTHVRDRWYKCLRCPSKFRDYLEYSDHKNNHQDQLS 514
            ..:||||||::|..|.|.||...:|..|:.||...|.|.|..|..:|:.:..||.|...|.   |
  Fly   318 ERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHS---S 379

  Fly   515 SRKSSIYESDDDGDSSVE---------DCLECCECQQRFTELDAYTAHLKKH 557
            .|:.|.........:||:         ....|..|.:.|:.:.|...|::.|
  Fly   380 ERQFSCDACPKTFRTSVQLYAHKNTHTKPYRCAVCNRPFSSMYAVKNHMQTH 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4496NP_001285707.1 zf-C2H2 245..267 CDD:278523 6/21 (29%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
zf-H2C2_2 259..282 CDD:290200 9/42 (21%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-C2H2 431..453 CDD:278523 6/21 (29%)
C2H2 Zn finger 433..453 CDD:275368 5/19 (26%)
zf-H2C2_2 445..468 CDD:290200 10/22 (45%)
C2H2 Zn finger 461..481 CDD:275368 7/19 (37%)
C2H2 Zn finger 489..510 CDD:275368 6/20 (30%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 8/82 (10%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 10/19 (53%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 9/24 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 2/19 (11%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.