DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ID4 and tap

DIOPT Version :9

Sequence 1:NP_001537.1 Gene:ID4 / 3400 HGNCID:5363 Length:161 Species:Homo sapiens
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:44 Identity:16/44 - (36%)
Similarity:29/44 - (65%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALET 110
            ::||...:||..:|::|...|::|:|||:...:||..|:..||:
  Fly   169 NLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLES 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ID4NP_001537.1 bHLH_dnHLH_ID4 62..117 CDD:381537 16/44 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..161
tapNP_524124.1 HLH 155..207 CDD:278439 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.