Sequence 1: | NP_001537.1 | Gene: | ID4 / 3400 | HGNCID: | 5363 | Length: | 161 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523876.2 | Gene: | emc / 38091 | FlyBaseID: | FBgn0000575 | Length: | 199 | Species: | Drosophila melanogaster |
Alignment Length: | 80 | Identity: | 33/80 - (41%) |
---|---|---|---|
Similarity: | 45/80 - (56%) | Gaps: | 14/80 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTC 131
Human 132 PAAPPRTPLTALNTD 146 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ID4 | NP_001537.1 | bHLH_dnHLH_ID4 | 62..117 | CDD:381537 | 27/49 (55%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 117..161 | 6/30 (20%) | |||
emc | NP_523876.2 | HLH | <37..80 | CDD:238036 | 22/41 (54%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143883 | |
Domainoid | 1 | 1.000 | 54 | 1.000 | Domainoid score | I11210 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1624054at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000920 | |
OrthoInspector | 1 | 1.000 | - | - | otm41367 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11723 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4557 |
SonicParanoid | 1 | 1.000 | - | - | X1045 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
11 | 10.940 |