DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACADM and Arc42

DIOPT Version :9

Sequence 1:NP_001272972.1 Gene:ACADM / 34 HGNCID:89 Length:454 Species:Homo sapiens
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:413 Identity:149/413 - (36%)
Similarity:217/413 - (52%) Gaps:39/413 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    42 TEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCDYSVCPLLEAC 106
            :|..:..|.:.|.||..|:...||::|:...||...||:..|||:|...|||             
  Fly    28 SETHQMLQKSCRDFANNELSGNAAKFDREHLYPEKQIRQMGELGVMAVAIPE------------- 79

Human   107 TLYLDAFFLLLTGSNLNLHLNLGGLGLGTFDACLISEELAYGC--TGVQTAIEGNSLGQMPIIIA 169
                                .|||.||......:..||::.||  .||..:: .|||...|::..
  Fly    80 --------------------ELGGTGLDYVAYAIAMEEISRGCASAGVIMSV-NNSLYLGPLLSF 123

Human   170 GNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANWY 234
            |||.|||.|:...|....:..:.::|||.|||.....|.|..|||.:::||.|.||||..:|...
  Fly   124 GNDAQKKDYITPFTTGERVGCFALSEPGNGSDAGAASTIATDKGDHFVLNGTKAWITNAFEAEAA 188

Human   235 FLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGD 299
            .:.|.::...|   :|..:.|||...|.|..:|:||..:|.|.|.|..::|||..|||||:|...
  Fly   189 IVFATTNKQLK---HKGISAFIVPKATKGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKENMLGEP 250

Human   300 GAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVE 364
            |.|||:||...|..|..:|..|:|:.|.||:.|..||.:|:.|||.:.:.|:|...:|:|::.:|
  Fly   251 GFGFKIAMQTLDAGRIGIAGQALGIGQAALELAVDYAQKRQAFGKPIAKLQSIQQKIADMSLAME 315

Human   365 LARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKI 429
            .||:...||||..|..:..|..|::||..|.:.|...:...:|||||.|:.|:...|:..|||:|
  Fly   316 SARLLTWRAAWLKDQKQPYTKEAAMAKLAASEAATLCSHQCIQILGGMGYVTDMAAERHYRDARI 380

Human   430 YQIYEGTSQIQRLIVAREHIDKY 452
            .:||||||:||||::|...:.:|
  Fly   381 TEIYEGTSEIQRLVIAGSILKEY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACADMNP_001272972.1 CaiA 39..453 CDD:224871 149/413 (36%)
MCAD 41..451 CDD:173846 148/410 (36%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 149/413 (36%)
SCAD_SBCAD 29..401 CDD:173847 148/408 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.