DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and Micu2

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_082919.1 Gene:Micu2 / 68514 MGIID:1915764 Length:432 Species:Mus musculus


Alignment Length:412 Identity:112/412 - (27%)
Similarity:192/412 - (46%) Gaps:77/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AGSDLHLHEGKKIREKVGFRE--RKIIEYEN---RIRQFSTPDKVFRYFATIQVPVADDRH--EV 197
            ||:....|.|   |.|...||  |.:...:|   .|.:.|...:.|..|::::       |  |.
Mouse    45 AGAGAAWHHG---RVKAAAREGSRTVSAQKNYLGPIEKLSLRKQRFMQFSSLE-------HDGEY 99

  Fly   198 YMTPTDFLTSMTPGMKQPDGLGLDQYRRYDPKSVGEQL-NLHLEK-----------NSIFYKLGS 250
            ||||.|||.|:             .:.:.:.|::.::| ...:|.           ::.|..||.
Mouse   100 YMTPRDFLFSV-------------MFEQVERKTLVKKLAKKDIEDVLSGIQTARCGSTFFRDLGD 151

  Fly   251 YGLITFSDYIFLLTVLSISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQ---TSMGTRHRD 312
            .|:|::::|:||||:|:.....|.:||:|.|::|:..::.:||..:..::.:|   .::.|...:
Mouse   152 KGVISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIERKEFVKLQKIISKQDGFKTVKTNETE 216

  Fly   313 HANTGNTFKGVNSALITYFFGPNMDEKLTIEKFLDFQEQLQREILSLE---------FERKEPND 368
            :.:......|||:.|...|||...::||..::|..|.|.||.|:..:|         |.|||   
Mouse   217 YQDPTVKEPGVNTTLQVRFFGKRGEKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKE--- 278

  Fly   369 EGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGKGISKQDYLDFFHFLNNINDVDTALT 433
                   ||||.||.:..  .:.|....:.|:.:. ..|:.||..::..|.||..::.|...|:.
Mouse   279 -------DFAEWLLFFTN--TENKDIYWRNVREKL-SVGESISLDEFKSFCHFTTHLEDFAIAMQ 333

  Fly   434 FYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEK 498
            .:.:|...:.....:...|......|||:::|.||.|||.:.|..||:.||:.|:|||:.|||  
Mouse   334 MFSLAHRPVRLAEFKRAVKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGL-- 396

  Fly   499 PKDTGFLKMMRSV---FKCAKE 517
                 ::...:||   :||.|:
Mouse   397 -----WVSQQQSVQEYWKCVKK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 14/40 (35%)
EF-hand_8 438..491 CDD:290545 18/52 (35%)
Micu2NP_082919.1 EF-hand_8 345..391 CDD:290545 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54184
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.