DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and MICU3

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001262741.1 Gene:MICU3 / 42357 FlyBaseID:FBgn0038735 Length:524 Species:Drosophila melanogaster


Alignment Length:486 Identity:133/486 - (27%)
Similarity:205/486 - (42%) Gaps:138/486 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KVKRMLTPKVDADAGQRPSSAADVNGEDKSSESE----------SEDSEDEEAGSDLHLHEGKKI 152
            |.:|:|| .|...|....:.||.:  :.:|:|:.          .:|||.|..            
  Fly    46 KTRRLLT-IVGGSAVSLAALAAFI--KLRSAENPVNAVSLKRRMRDDSELENV------------ 95

  Fly   153 REKVGFRERKIIEYENRIRQFSTPDKVFRYFATIQVPVADDRHEVYMTPTDFLTSMT-----PGM 212
              |:..|||:.|:                 ||:::.   ||  ::||||.|||.|:.     |.:
  Fly    96 --KLTARERRFIK-----------------FASVEY---DD--QLYMTPQDFLDSVVEQEPRPRL 136

  Fly   213 K--QPDGLGLDQYRRYDPKSVGEQLNLHLEKNS--IFYKLGSYGLITFSDYIFLLTVLSISRRHF 273
            |  |.....:|:|:...|.         |:|.|  :|..|...|::::::|:|||::|:..:..|
  Fly   137 KRRQLSSDEVDKYKENTPA---------LKKGSTRLFRNLRDKGIVSYTEYLFLLSILTKPKSGF 192

  Fly   274 EIAFRMFDLNGDGDVDCEEF-----------------------------------EMVATLVRQQ 303
            .|||.|||.:|:..||.:||                                   :|...:...|
  Fly   193 RIAFNMFDTDGNQRVDKDEFLVIISILAGALKDTQNVDPQTKRILSRLVSYDEQSQMTKPMAVPQ 257

  Fly   304 TSMGTRHR---------------------------DHANTGNTFKG---VNSALITYFFGPNMDE 338
            ...|...|                           ::.|.|...:.   |.:.|..:|||.....
  Fly   258 AKRGIMERIFSGAWKEKHGEQEPEEELATPTPLEQNYVNDGEGLQRRHMVATTLQLHFFGKRGTG 322

  Fly   339 KLTIEKFLDFQEQLQREILSLEFERKEPNDEGN--ITEADFAELLLAYAGYPLKKKQKKLKRVKR 401
            .:..:.|..|.:.||.|:|.|||..   ..:||  |:|.|||::||.|......:....|:|:..
  Fly   323 VINYDNFYRFMDNLQTEVLELEFHE---FSKGNSVISELDFAKILLRYTYLATDEYDVFLERLLE 384

  Fly   402 RFRDHGKGISKQDYLDFFHFLNNINDVDTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDV 466
            |.:|. ||||..|:.||.|||||::|...|:..|.:|..:|.:.......|......||.|::|.
  Fly   385 RVKDE-KGISFHDFRDFCHFLNNLDDFTIAMRMYTLADRAISKDEFSRAVKICTGYKLSPHLIDT 448

  Fly   467 VFTIFDENNDNQLSNKEFISVMKNRVQRGLE 497
            ||.|||.:.|..||.||||::||:|:.||.:
  Fly   449 VFAIFDADGDGLLSYKEFIAIMKDRLHRGFK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 16/40 (40%)
EF-hand_8 438..491 CDD:290545 21/52 (40%)
MICU3NP_001262741.1 EF-hand_7 421..470 CDD:290234 18/48 (38%)
EF-hand_8 424..473 CDD:290545 20/48 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456388
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D38732at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12294
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.