DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and MICU3

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_859074.1 Gene:MICU3 / 286097 HGNCID:27820 Length:530 Species:Homo sapiens


Alignment Length:488 Identity:127/488 - (26%)
Similarity:197/488 - (40%) Gaps:131/488 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PKVDADAGQRPSSAADVNGED-------------KSSESESEDSEDEEAGSDLHLHEGKKIREKV 156
            |:..:.|..|||.:|....||             .:.|:.:....|.|   ||.|:...      
Human    89 PRAGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVAIGRTDIE---DLDLYATS------ 144

  Fly   157 GFRERKIIEYENRIRQFSTPDKVFRYFATIQVPVADDRHEVYMTPTDFLTSMTPGMKQPDGLGLD 221
              |||:                 ||.||:|:.     ..:::|||.||:.::|..          
Human   145 --RERR-----------------FRLFASIEC-----EGQLFMTPYDFILAVTTD---------- 175

  Fly   222 QYRRYDP------KSVGEQ-LNLHLEK--------NSIFYKLGSYGLITFSDYIFLLTVLSISRR 271
                 :|      ||:.:| ||..|.:        :.:|..|...|:|::::|:|||.:|:....
Human   176 -----EPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHA 235

  Fly   272 HFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSMGTRHRD--------------HANTGNTFKG 322
            .|.|||.|||.:|:..||.:||.::..:.|::........|              |:.|.:..|.
Human   236 GFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKT 300

  Fly   323 -------------------------------------VNSALITYFFGPNMDEKLTIEKFLDFQE 350
                                                 .::.|:.:|||.....:|..|.|..|.:
Human   301 DAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKKGKAELNFEDFYRFMD 365

  Fly   351 QLQREILSLEFERKEPNDEGNITEADFAELLLAYAGYPLKKKQKKLKRVKRRFRDHGKGISKQDY 415
            .||.|:|.:|| ....|....|:|.|||.:||.|..  ::.....|:.|:....:. |||:..::
Human   366 NLQTEVLEIEF-LSYSNGMNTISEEDFAHILLRYTN--VENTSVFLENVRYSIPEE-KGITFDEF 426

  Fly   416 LDFFHFLNNINDVDTALTFYHIAGASIDQQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLS 480
            ..||.||||:.|...||..|:.|..||.|...:........:..|.|:|:.||.|||.:.|:|||
Human   427 RSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQLS 491

  Fly   481 NKEFISVMKNRVQRGLEKPKDTGFLKMMRSVFK 513
            .||||.:||:|:.||....|........:|..|
Human   492 YKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 17/40 (43%)
EF-hand_8 438..491 CDD:290545 22/52 (42%)
MICU3NP_859074.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..115 7/22 (32%)
PTZ00183 238..366 CDD:185503 24/127 (19%)
EF-hand_8 449..502 CDD:290545 22/52 (42%)
EF-hand_7 <452..499 CDD:290234 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.