DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICU1 and MICU2

DIOPT Version :9

Sequence 1:NP_001097110.1 Gene:MICU1 / 33999 FlyBaseID:FBgn0031893 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_689939.1 Gene:MICU2 / 221154 HGNCID:31830 Length:434 Species:Homo sapiens


Alignment Length:464 Identity:123/464 - (26%)
Similarity:201/464 - (43%) Gaps:97/464 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VMDW-GKVKRMLTPKVDADAGQRPSSAADVNGEDKSSESESEDSEDEEAGSDLHLHEGKKIREKV 156
            |..| ||::|.|.....|.....|.:|| |.|...:.           ||:..| |....:..:.
Human    11 VAAWGGKLRRGLAVSRQAVRSPGPLAAA-VAGAALAG-----------AGAAWH-HSRVSVAARD 62

  Fly   157 G---FRERKIIEY-----------ENRIRQFSTPDKVFRYFATIQVPVADDRHEVYMTPTDFLTS 207
            |   ...:|.:|:           :.|..|||:               .:...|.||||.|||.|
Human    63 GSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSS---------------LEHEGEYYMTPRDFLFS 112

  Fly   208 -MTPGMKQPDGLGLDQYRRYDPKSVGEQLNLHLEK----NSIFYKLGSYGLITFSDYIFLLTVLS 267
             |...|::...:     ::...|.:.:.|: .::.    ::.|..||..|||::::|:||||:|:
Human   113 VMFEQMERKTSV-----KKLTKKDIEDTLS-GIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILT 171

  Fly   268 ISRRHFEIAFRMFDLNGDGDVDCEEFEMVATLVRQQTSMGTRHRDHANTGNTFKG---------- 322
            .....|.:||:|.|.:|:..::..||..:..::.:|..:.|     ..|..|  |          
Human   172 KPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDLMT-----VKTNET--GYQEAIVKEPE 229

  Fly   323 VNSALITYFFGPNMDEKLTIEKFLDFQEQLQREILSLE---------FERKEPNDEGNITEADFA 378
            :|:.|...|||.....||..::|..|.|.||.||..:|         |.|||          |||
Human   230 INTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKE----------DFA 284

  Fly   379 ELLLAYAGYPLKKKQKKLKRVKRRFRDHGKGISKQDYLDFFHFLNNINDVDTALTFYHIAGASID 443
            |.||.:..  .:.|....|.|:.:. ..|:.||..::..|.||..::.|...|:..:.:|...:.
Human   285 EWLLFFTN--TENKDIYWKNVREKL-SAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVR 346

  Fly   444 QQTLQHVAKTVAMVNLSDHVVDVVFTIFDENNDNQLSNKEFISVMKNRVQRGLEKPKDTGFLKMM 508
            ....:...|......||::::|.||.|||.:.|..||::||:.|:|||:.|||..|:.    :.:
Human   347 LAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQH----QSI 407

  Fly   509 RSVFKCAKE 517
            :..:||.|:
Human   408 QEYWKCVKK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICU1NP_001097110.1 EFh <252..293 CDD:298682 15/40 (38%)
EF-hand_8 438..491 CDD:290545 17/52 (33%)
MICU2NP_689939.1 EFh_MICU2 176..395 CDD:320082 67/238 (28%)
EF-hand motif 176..205 CDD:320082 8/28 (29%)
EF-hand motif 233..263 CDD:320082 11/29 (38%)
EF-hand motif 329..358 CDD:320082 4/28 (14%)
EF-hand motif 366..395 CDD:320082 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54184
OrthoDB 1 1.010 - - D425365at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.